KEGG   Hoeflea sp. IMCC20628: IMCC20628_02245Help
Entry
IMCC20628_02245   CDS       T03926                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
hoe  Hoeflea sp. IMCC20628
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hoe03012]
    IMCC20628_02245
   03029 Mitochondrial biogenesis [BR:hoe03029]
    IMCC20628_02245
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hoe04147]
    IMCC20628_02245
Translation factors [BR:hoe03012]
 Eukaryotic Type
  Elongation factors
   IMCC20628_02245
 Prokaryotic Type
   IMCC20628_02245
Mitochondrial biogenesis [BR:hoe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    IMCC20628_02245
Exosome [BR:hoe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   IMCC20628_02245
  Exosomal proteins of breast cancer cells
   IMCC20628_02245
  Exosomal proteins of colorectal cancer cells
   IMCC20628_02245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AKI00947
UniProt: A0A0F7PI86
LinkDB All DBs
Position
complement(2332268..2333443)
Genome map
AA seq 391 aa AA seqDB search
MAKGKFERNKPHVNIGTIGHVDHGKTSLTAAITKFFGEYKAYDQIDAAPEEKARGITIST
AHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPSLVVFLNKVDQVDDEELLELVEMEVRELLSSYDFPGDDIPIIKGSALVALNDGDKT
IGEDAIRALMAAVDEYIPTPERPINMPFLMPIEDVFSISGRGTVVTGRVERGVVKVGEEV
EIVGIRDTQKTVCTGVEMFRKLLDQGQAGDNIGALLRGVGREDVERGQILCKPGSVKPHT
KFTAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNISAEVAL
IVPIAMEEKLRFAIREGGRTVGAGIVATIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagggtaagttcgagcgtaacaagccgcatgtgaacatcggcacgattggtcac
gttgaccacggcaagacgtcgttgacagctgcgatcaccaagttctttggtgagtacaag
gcctatgaccagattgacgcggcaccggaagaaaaggcccgcggcatcaccatttcgacg
gcccatgtcgagtatgagaccgaggcccgtcactacgcccatgtcgactgcccaggccac
gccgactatgtcaagaacatgatcaccggtgctgcgcagatggacggcgcgatcctggtt
gtgtcggctgccgacggcccgatgccccagacccgcgagcacatcctgctggcccgtcag
gttggcgtgccttcgctggtggtgtttttgaacaaggtcgaccaggttgacgacgaagag
cttctcgagctcgtcgaaatggaagtccgcgaacttctgtcgtcctacgatttcccgggc
gacgatattccgatcatcaagggttcggcgcttgtcgcgctcaacgatggcgacaagaca
atcggcgaagacgccatccgcgcgctgatggccgctgttgacgaatacatcccgacgcct
gagcgtccgatcaacatgccgttcttgatgccgatcgaagacgtgttctcgatctcgggt
cgtggcacggttgtcaccggtcgtgttgagcgcggcgttgtcaaggttggcgaagaagtc
gaaatcgtcggcatccgcgacacccagaagacggtctgcaccggcgttgaaatgttccgc
aagctgctcgatcagggccaggctggcgacaacatcggcgcactgcttcgcggcgttggt
cgtgaagacgtcgagcgtggccagatcctgtgcaagccgggttcggtcaagccgcacacc
aagttcacggcagaagcctacattctgaccaaggaagagggtggccgtcatacgccgttc
tttaccaactaccgtccgcagttctatttccgcacgaccgacgtgacgggcattgtgaca
ctgccggaaggcaccgaaatggtgatgccgggcgacaacatctcggctgaagttgcactg
atcgtgccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgcacc
gtcggcgccggcatcgtcgctacgatcatcgagtaa

DBGET integrated database retrieval system