KEGG   Hoeflea sp. IMCC20628: IMCC20628_02293Help
Entry
IMCC20628_02293   CDS       T03926                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe00970  Aminoacyl-tRNA biosynthesis
hoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IMCC20628_02293
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hoe03029]
    IMCC20628_02293
Enzymes [BR:hoe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     IMCC20628_02293
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     IMCC20628_02293
Mitochondrial biogenesis [BR:hoe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    IMCC20628_02293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AKI00992
UniProt: A0A0F7PIC7
LinkDB All DBs
Position
complement(2386911..2388413)
Genome map
AA seq 500 aa AA seqDB search
MTLVDTRTPEPKRFVAGATGDWEIVIGLEVHAQVTSNSKLFSGASTEFGNAANSNVSLVD
AAMPGMLPVINEECVAQAVRTGLGLKAQINNRSVFDRKNYFYPDLPQGYQISQFKDPIVG
EGEIIISVGPDRKGNFEDIEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS
KPDMRSADEAKAYVTKLRSILRYLGTCDGNMDEGSMRADVNVSVRKPGGDFGTRCEIKNV
NSIRFIGQAIDYEARRQIAIIEDGGTIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD
LLPLEFDDAYVAALKADLPELPDDKKARLVRDMGLSVYDASILVSEKAIADYYEELAAGR
DGKTAANWVINDLLGGLNKAGKGIEETPVSPAQLGGILDLIKDDTISGKIAKDLFEIVFN
EGGNPAEIVEARGMKQVTDTGAIEKAVDEIIAANPDQVAKVVAKPALAGWFVGQVMKATG
GKANPKAVQELVKTKLGIED
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgttgatacccgcacccctgaacccaagcgctttgttgctggcgccaccggc
gattgggagattgtcattggtctcgaagttcacgctcaggtgaccagcaattccaagctg
ttctcgggcgcctcgacggaattcggcaatgccgccaattccaatgtcagtctggttgac
gcggcaatgccaggcatgctgcctgtgatcaacgaggaatgcgtcgctcaggccgtgcgc
accgggcttggcctgaaagcgcagatcaacaaccgttcggtgtttgaccgcaagaactat
ttctatcccgatctgccgcagggctatcagatttcgcagttcaaggatccgattgtcggc
gagggcgaaatcatcatctcggtcggtccggaccgcaagggcaatttcgaggacatcgag
atcggcatcgagcggctgcatctggagcaggacgccggcaagtcgatgcacgaccagcac
ccgaccatgtcctatgtcgatctcaaccgctccggcgtggcgctgatggagatcgtctcg
aaacccgacatgcgctcggctgacgaggccaaggcctatgtcaccaaactcaggtcgatc
ctgcgctatctcggcacctgcgacggcaacatggacgaaggctcgatgcgtgccgacgtc
aatgtctcggtgcgtaagcccggcggcgatttcggcacccgctgcgagatcaagaacgtc
aactcgatccgattcatcggtcaggccatcgactacgaagcccgccgccagatcgccatc
atcgaagacggcggcaccatcgaccaggaaacccggctgtttgatcccggcaagggcgaa
acccgctcgatgcggtcgaaggaagatgcgcatgactatcgctatttccccgatcccgat
ctgctgccgctggaattcgacgatgcctatgtcgccgcgttgaaggcggatctgcctgaa
ttgcctgacgacaagaaggcgcgcctggtgcgtgacatgggcctgtcggtctacgacgct
tcaatcctggtctcggaaaaggcgattgccgattattacgaggaactggccgccgggcgt
gacggcaagaccgccgccaactgggtcatcaacgacttgctgggcggcttgaacaaagcc
ggcaaaggcattgaagagactccggtttcgcccgctcagcttggcggcattctggatctg
atcaaggacgacaccatttccggcaagatcgccaaggacctgttcgagatcgtctttaac
gagggcggcaacccggccgagatcgtcgaagccaggggcatgaagcaggtcaccgacacc
ggcgccatcgaaaaggctgtcgatgaaatcatcgccgccaaccccgatcaggtggccaag
gtcgtggccaaaccggccctggctggctggttcgtcggtcaggtgatgaaggccaccggc
ggcaaggccaatccgaaagccgtgcaggaactggtcaagaccaagctcggcatcgaggac
tga

DBGET integrated database retrieval system