KEGG   Hoeflea sp. IMCC20628: IMCC20628_02933Help
Entry
IMCC20628_02933   CDS       T03926                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe00250  Alanine, aspartate and glutamate metabolism
hoe00410  beta-Alanine metabolism
hoe00640  Propanoate metabolism
hoe00650  Butanoate metabolism
hoe01100  Metabolic pathways
hoe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    IMCC20628_02933
   00650 Butanoate metabolism
    IMCC20628_02933
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IMCC20628_02933
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IMCC20628_02933
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hoe01007]
    IMCC20628_02933
Enzymes [BR:hoe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     IMCC20628_02933
Amino acid related enzymes [BR:hoe01007]
 Aminotransferase (transaminase)
  Class III
   IMCC20628_02933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKI01627
UniProt: A0A0F7PK27
LinkDB All DBs
Position
3051548..3052843
Genome map
AA seq 431 aa AA seqDB search
MGKNADIQTRKTDAIARGVGMMTQIYADRAENAEIWDVEGNRYIDFAAGIAVVNTGHRHP
KVIEAVKAQLDRFTHTCHQVIPYENYVHLAERLNTLAPGDFDKKTVFVTTGAEAVENAVK
IARAATGRPAVVSFSGSFHGRTFMGMALTGKVFPYKAGFGAMPSDVYHVPFPIELHGVSV
AQSLAALETLFKADVDPARVAAIIVEPVQGEGGFYEVPAGFFKSLREICDKHGILLIADE
IQTGFARTGKMFAMEYHGVAPDLMTMAKGLAGGFPLAAVTGRAEIMDAANPGGLGGTYGG
NPIGIAAAHAVLDVIEEEQLCDRAMQLGNRLKQRLQGIREDVPEIVDIRGPGFMNAIEFN
DAKTGKPSPDFANAVKGRALEKGLILLTCGVYANVIRFLSPITIQDPVFQEALDLLEASI
REVHSEIGANA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaacgccgacatccaaacccgcaagaccgatgccatcgcacgcggtgttggc
atgatgacgcagatctatgccgaccgcgccgaaaacgccgaaatctgggacgtcgaaggc
aaccgctatatcgacttcgccgccggaatcgccgtggtcaacactggccaccgtcacccc
aaggtgatcgaagcggtgaaagcccagctcgaccgcttcacccacacctgccatcaggtc
attccttatgagaattatgttcatctggccgaacggctgaatacgctggcaccgggcgat
ttcgacaagaagacggtgtttgtaaccactggcgctgaagccgtggaaaatgccgtcaag
atcgcccgcgccgccaccggacgcccggcagtggtatcgttttccggcagctttcatggc
cgcaccttcatgggcatggcgctgaccggcaaagtgttcccctacaaggcaggattcggc
gcaatgccgagcgacgtctatcacgtccccttccctattgaactgcatggcgtctcggtc
gcgcagtcactcgcggcactcgagaccctgttcaaggccgatgtcgaccccgcgcgggtg
gcagcgatcattgtcgagccggttcagggcgaaggcgggttttacgaagttccggcaggg
ttcttcaaatcattgcgcgagatctgcgacaaacatggcattttgctgatcgcagacgag
atccagaccgggttcgcccgaaccggcaaaatgttcgccatggagtatcacggcgtggcg
ccggatctgatgacgatggccaagggactggctggcggatttccgctggcagctgtcacc
ggccgggccgagatcatggatgctgccaatccgggtggattgggcggcacctatggcggc
aatccgatcggcatcgcagcagcccatgctgtgcttgacgtgatcgaggaagaacagctt
tgcgaccgcgccatgcagcttggcaatcgtctgaagcagcggttgcagggcatccgcgaa
gatgtgcccgagatcgtcgacatccgtggccccggtttcatgaacgccatcgagttcaac
gacgccaagaccggcaagccaagccctgattttgccaatgccgtcaaaggccgggccctt
gaaaaaggcctgatacttctcacctgtggggtatatgccaatgtcatccgcttcctttcg
ccgataaccattcaggatccggtgttccaggaagcgttggaccttctcgaagcatccatt
cgcgaagtccattcagaaatcggagccaacgcataa

DBGET integrated database retrieval system