KEGG   Haliangium ochraceum: Hoch_2539Help
Entry
Hoch_2539         CDS       T01103                                 

Definition
(GenBank) Uracil-DNA glycosylase superfamily
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
hoh  Haliangium ochraceum
Pathway
hoh03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hoh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Hoch_2539
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hoh03400]
    Hoch_2539
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Hoch_2539
DNA repair and recombination proteins [BR:hoh03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Hoch_2539
 Prokaryotic type
     Hoch_2539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ACY15074
UniProt: D0LKM6
LinkDB All DBs
Position
complement(3507609..3508250)
Genome map
AA seq 213 aa AA seqDB search
MTPTANPPAQRATQRALRTHIDALRLCRLCPDMHAPPIPGPPVVSPLMLLGQAPGRHEGR
VGRPFGWKAGKTLFTWFAGIGLPEEALRQRVYIAAVCRCFPGPHPSGGGDRVPKRAEIER
CHGWLAREIELLRPRLIIPIGKLAIAQLMPVRKLSEVVGGCHRIAFAGHTLDAIPLPHPS
GISTWHRRPPGSLLLAEALERIAAHAAFNRLLR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgactcccacagcaaacccaccggcgcagcgcgcgacccagcgcgcactgcgcacacac
atcgacgccctccgcctgtgccgcctgtgtcccgatatgcacgcgccgccgatcccgggc
ccgcccgtggtctcgccgctcatgctcctgggccaggcacccggccgtcacgagggccgc
gttggacgccctttcggctggaaggcgggcaagaccctgttcacctggttcgccggcatc
ggcctgcccgaggaggcgctgcgccagcgcgtgtacatcgcggccgtgtgccgctgcttc
cccggtccgcacccgagcggcggcggtgaccgcgtccccaaacgcgccgagatcgagcgc
tgtcacggctggctcgcgcgcgagatcgagctcttgcgaccgcgcctcatcatcccgatc
ggcaagctggccatcgcccagctcatgccggtgcgcaagctgagcgaggtggtgggcgga
tgtcaccgcatcgcgttcgccggacacacgctcgacgccatccccctgccccatccctcc
ggcatctcgacctggcatcggcgcccgccgggctcgctgctgctggccgaagcgctcgag
cgcatcgccgcgcacgcagccttcaacaggctgctaaggtaa

DBGET integrated database retrieval system