KEGG   Haliangium ochraceum: Hoch_5632Help
Entry
Hoch_5632         CDS       T01103                                 

Definition
(GenBank) Linoleoyl-CoA desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
hoh  Haliangium ochraceum
Pathway
hoh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    Hoch_5632
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hoh01004]
    Hoch_5632
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     Hoch_5632
Lipid biosynthesis proteins [BR:hoh01004]
 Desaturase
  Front-end
   Hoch_5632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase CutA1 DUF4191
Motif
Other DBs
NCBI-ProteinID: ACY18109
UniProt: D0LG84
LinkDB All DBs
Position
complement(7731336..7732451)
Genome map
AA seq 371 aa AA seqDB search
MSSDVRKRPHFLPHSALRRDLERRIDAYFQETGLSRDGGSWMVAKSLSIMAWAILSYIVL
VFVASTWWMVVPAAVSLGLAIACIGFSIQHDGNHGAYSSSSRLNALATWSLDLIGGSSFV
WRQKHNVLHHTFTNVGDVDDDIHAWPFLRLAPHQRRLWFHRFQHMYFPVLLGLFFTSKWA
VWDDFHVLATGRIGEQKVPRPRGKNLAVMLLGKALFFTWALAIPLMLHSVAVVLPVYLLT
TAVLGITLGVVFQLAHAVDETDFPEPAADTNRLSRPFLEHQLATTANFAPKNRVITWYVG
GLNFQVEHHMFPKISHRHYPALSPIVREVCHEHGVPYIMHETMSGAFRSHLRYLARLGAS
PVVAINAVPAA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgagttccgacgtacgcaaacgaccgcatttccttcctcactccgcgttgcgccgcgac
ctcgagcgccggattgacgcgtacttccaggaaacaggcctgtcgcgcgatggcggctcc
tggatggtagccaagtcgctgagcatcatggcgtgggcgatcttgtcctacatcgtgttg
gtgttcgtcgcctcgacctggtggatggtggtaccggccgcggtgtcgctgggtctggcc
atcgcctgcatcggtttctcgattcagcacgacggcaaccacggcgcgtactcgagcagc
tcgcgcctcaacgcgctggcgacctggtctctggacctgatcggcggcagctcgtttgtg
tggcgccagaagcacaatgtcctgcaccacaccttcaccaacgtgggggacgtggacgat
gacatccacgcgtggccgtttctccggctggcgccccaccagcggcggctgtggttccat
cgctttcagcacatgtatttcccggtgctgctgggtctgttcttcaccagcaagtgggcg
gtgtgggacgacttccacgtgctggccaccggccgcatcggcgagcagaaggtgccgcgg
ccgcgcggtaagaacctggcggtgatgctcctcggcaaggcgctgttcttcacctgggcg
ctggccattcccctgatgctgcactcggtcgccgttgtcctgccggtgtacctgctgacc
accgcggtcctcggcatcaccctgggcgtggtttttcagctcgctcatgcggtcgacgag
accgacttccccgagcccgcggccgataccaaccgcctcagccgccccttcctcgagcat
cagctcgcgaccacggcgaacttcgcgcccaagaatcgcgtgatcacctggtacgtgggc
ggtctcaacttccaggtcgagcaccacatgttccccaagatctcgcaccgccactacccg
gcgctgtcgccgatcgtgcgcgaggtctgccacgagcacggcgtgccctacatcatgcac
gagaccatgagcggcgcgttccgctcgcatctgcgctacctggcccgtctcggcgcgtcg
ccggtggtcgcgatcaacgcggtcccggcggcctga

DBGET integrated database retrieval system