KEGG   Haliangium ochraceum: Hoch_6422Help
Entry
Hoch_6422         CDS       T01103                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hoh  Haliangium ochraceum
Brite
KEGG Orthology (KO) [BR:hoh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hoh01002]
    Hoch_6422
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hoh04147]
    Hoch_6422
   04090 CD molecules [BR:hoh04090]
    Hoch_6422
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Hoch_6422
Peptidases [BR:hoh01002]
 Metallo Peptidases
  Family M2
   Hoch_6422
Exosome [BR:hoh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hoch_6422
CD molecules [BR:hoh04090]
 Proteins
  Hoch_6422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ACY18891
UniProt: D0LQ82
LinkDB All DBs
Position
complement(8806620..8808485)
Genome map
AA seq 621 aa AA seqDB search
MRSRDQLASVLAALSLLVGAGCGSGQSSSETAASAAEDGDGEAAQSEQPSAADAQAFIDE
YERERYDLARKQAQAAWVRATYITDDTAALAADVDVEMMAFSAAKAHEAQRFADLPLDGE
LGRKLALIRLSETTPGPDAPEKREALAQALNEMQRIYGTGKYCPSEGTCWNLTELSQRLA
KSRNPKELLEVWTGWRSVTAEMRGEFERFVELANEGARDMGFDDLGALWRSKYDMQPDET
AAEVDRLWGQVQPLYEQLHCYVRGKLSQQYGASVVPDEGAIPAHVLGNMWAQDWSYLSWL
VTPGGNRAQVSEITRALKAKRVDAVGMVRYAERFFVSLGMPELPQSFWDRSMLVRPRDRE
VECHASAWSLDWKEDLRIKMCIEINDEDFSTIHHELGHIYYDWAYKDQPILFADSAHDGF
HEALGDTIALSVTPSYLKEIGLVPRSSQNDTAQLLDRALQKVAFLPFGLLVDKWRWQVFS
GEVGPENYNEAWWKLREQYQGVRPPSERSESDFDPGAKYHVASNVPYLRYFLAHVLQFQL
HRSLCEAAGHEGPLHQCSIYGSKEAGAKLQAMMELGASKPWPEALALITGDDQMDASAMI
EYFAPLMTWLEQQNQGRTCGY
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctagagaccagttggcgtcggtacttgcggcgctctccctcctcgttggcgcg
ggctgtggctcgggccagtcctcctcggaaaccgcggccagcgcagcggaagacggcgac
ggtgaagccgcccagagcgagcagccgagcgcggccgacgctcaggccttcatcgacgag
tacgagcgcgagcgctacgacctggcgcgcaagcaggcccaggcggcctgggtgcgcgcc
acgtacatcaccgacgacacggccgcgctggcggccgacgtcgacgtcgagatgatggcg
tttagcgccgccaaggcgcacgaggcgcagcgcttcgccgatctgccgctcgacggcgag
ctggggcgcaagctggcgctcatccgcctgagcgagaccacgcccggtcccgacgcgccc
gagaaacgcgaggccctggcgcaggcgctcaacgagatgcagcgcatctacggcaccggc
aaatactgccccagcgagggcacctgctggaacctcaccgagctgtcgcagcgcctggcc
aagagccgcaatcccaaggagctgctcgaggtgtggaccggctggcgctcggtcacggcc
gagatgcgcggcgagttcgagcgcttcgtggagctcgccaacgagggcgcgcgcgacatg
ggcttcgacgatctgggcgcgctgtggcgctccaagtacgacatgcagcccgatgagacg
gcggccgaggtcgatcgcctgtggggccaggtgcagccgctctacgagcagctccactgc
tacgtgcgcggcaagctgtcacagcaatacggcgccagcgtggtgcccgacgagggcgcg
atcccggcgcacgtgctcggcaacatgtgggcccaggactggagctatctgtcgtggctg
gtgaccccgggcggcaatcgcgcccaggtgtccgaaatcacccgcgcgctcaaggccaag
cgggtcgacgccgtgggcatggtgcgctacgccgagcgcttcttcgtgtcgctgggcatg
cccgagctgccgcagagcttctgggatcgctcgatgctggtgcgcccgcgcgaccgcgag
gtcgagtgccacgccagcgcctggagcctcgactggaaagaggatctgcgcatcaagatg
tgcatcgagatcaacgacgaggacttctcgaccatccaccacgagctcggccacatctat
tacgactgggcgtacaaagaccagccgattctgttcgccgacagcgcgcacgacggcttc
cacgaggcgctcggcgacaccatcgcgctgtcggtgacgccctcgtacctcaaggagatc
ggcctggtgccgcgttcgagccagaacgacaccgcccagctcctcgaccgcgcgctgcag
aaggtcgcctttctgcccttcggcctgctggtggacaagtggcgctggcaggtgttctcg
ggcgaagtcggccccgagaactacaacgaggcctggtggaagctgcgcgagcagtaccag
ggcgtgcgtccgccgagcgagcgcagcgagagcgatttcgaccccggcgccaagtaccac
gtggcctcgaacgtgccctatctgcgctacttcctggcccacgtgctgcagttccagctc
caccgctcgctgtgcgaggccgccggtcacgaggggccgctgcaccagtgctcgatctac
ggcagcaaagaggccggcgcgaagctgcaggcgatgatggagctgggcgcgtcgaagccc
tggcccgaggcgctggccctgatcacgggcgacgaccagatggatgcctcggccatgatc
gaatacttcgctccgctgatgacctggctcgagcagcagaaccagggccgcacctgcggc
tactga

DBGET integrated database retrieval system