KEGG   Halomonas olivaria: HORIV_25130Help
Entry
HORIV_25130       CDS       T06227                                 

Definition
(GenBank) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
hol  Halomonas olivaria
Pathway
hol00564  Glycerophospholipid metabolism
hol01100  Metabolic pathways
hol01110  Biosynthesis of secondary metabolites
Module
hol_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:hol00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HORIV_25130
Enzymes [BR:hol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     HORIV_25130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: BBI50092
UniProt: A0A3T1DND2
LinkDB All DBs
Position
complement(1759442..1759981)
Genome map
AA seq 179 aa AA seqDB search
MQAGQLVQAKGHTYSAQTLLGGDTALAEEFLGGSFATVYLSPRDYHRVHMPVTGTLREMI
YVPGRLFSVNQATANYVPGLFARNERLVCIFDTEHGPMAMVLVGAMIVAAIETVWSGQVT
PLSGHPQRMQFGQPITLEKGAEMGRFKLGSTVVMCFANQVNFADIPPGAMVQMGQTLGK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggcagggcaactggtgcaagcgaaaggccacacctactcagcgcaaaccctgcta
ggcggcgacacggcgctggcagaagagtttttgggcggcagctttgccacggtttaccta
tcgccacgggactaccatcgagtgcatatgccggtgaccggcaccctgcgcgaaatgatc
tacgtcccaggtcggctattctcggtcaaccaagccaccgccaactatgtaccggggctg
tttgcccgcaatgaacgcctggtatgtatctttgataccgaacacggcccaatggccatg
gtgctagtcggcgccatgattgtcgcggctatcgaaaccgtctggtcggggcaagtaacg
ccgctttcgggtcatccccagcgcatgcagtttgggcagcccattacgctagaaaaaggt
gccgagatgggacgcttcaagctcggctccacggtggtcatgtgctttgccaaccaagtc
aatttcgccgacattccccccggcgccatggtgcaaatgggtcagacgctgggaaaatga

DBGET integrated database retrieval system