KEGG   Halomonas olivaria: HORIV_44550Help
Entry
HORIV_44550       CDS       T06227                                 

Gene name
cysA1
Definition
(GenBank) sulfate/thiosulfate import ATP-binding protein CysA 1
  KO
K02045  sulfate/thiosulfate transport system ATP-binding protein [EC:7.3.2.3]
Organism
hol  Halomonas olivaria
Pathway
hol00920  Sulfur metabolism
hol02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hol00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    HORIV_44550 (cysA1)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HORIV_44550 (cysA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hol02000]
    HORIV_44550 (cysA1)
Enzymes [BR:hol01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.3  ABC-type sulfate transporter
     HORIV_44550 (cysA1)
Transporters [BR:hol02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    HORIV_44550 (cysA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_3 AAA_21 TOBE AAA_23 SMC_N TOBE_2 AAA_22 NACHT AAA AAA_16 AAA_25 SbcCD_C AAA_24 AAA_29 RsgA_GTPase AAA_18 AAA_33 AAA_5 cobW AAA_30 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: BBI52034
UniProt: A0A3T1DTX5
LinkDB All DBs
Position
3014715..3015773
Genome map
AA seq 352 aa AA seqDB search
MSIHLHNIAKHFGNTQALEPINLDIHDGELVGLLGPSGSGKTTLLRIIAGLESADHSAQP
GKILFGDRDVTNVHVRDRRIGFVFQHYALFRHMSVYDNVAFGLTVLSRKRRPSSGEIRAR
VFRLLEMVKLEHLANRYPAQLSGGQQQRVSLARALAVEPEVLLLDEPFGALDAKVRQELR
RWLRHLHDEFNFTSVFVTHDQEEALELSDRVVVMSNGRIEQIDTPDELYREPKNRFVFEF
LGDVNHLEGNITNGVLTCGDAYWHVDLPDGHEELLLRPHEVRLTEQPTAESHLPVTITAI
SPVGAEVRVELEADWLAQPWLATVRHTDFEHLSLRRGQRLFAHPRHWRRFPK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcacttacacaacatcgccaaacacttcggcaacactcaggcattagagcca
attaacctggatattcacgatggtgagctggttggcctgctgggcccgtctggttcaggc
aagaccaccttgctgcggattatcgccggcctggagagtgccgaccactcggcccagccg
ggtaaaattctgtttggtgaccgcgacgtgaccaatgtgcatgtgcgtgatcgtcgcatt
ggctttgttttccagcactacgcgctgttccgccatatgagcgtttacgacaatgttgcc
tttggactgaccgtgctgtcgcgtaaacgccgccccagtagcggtgaaattcgcgcacgg
gtgtttaggctgcttgaaatggtcaagctggaacacctggccaaccgctacccggcgcag
ctttccggcggccagcagcagcgtgtgtcgcttgctcgcgcgttggccgtggagccggaa
gtactgctgctcgacgaaccctttggcgcgcttgatgccaaggtgcgtcaagagcttcgc
cgctggctacgccacctgcatgacgagttcaatttcaccagcgtctttgtcacccacgac
caggaggaagcgctggagctttctgaccgtgtggtagtgatgagcaatggtcgcattgag
caaattgatacccccgatgagctctaccgtgagcccaaaaaccgctttgtgttcgagttt
ttaggcgatgtgaatcacctggaaggcaacataaccaacggcgtcctcacctgcggtgac
gcctattggcacgtggatctacccgatggtcacgaagagctgctgctgcgccctcacgaa
gtgcggctaaccgagcagcccaccgctgagagccacctgccagtcaccatcacggcgatc
tcgccggtgggcgccgaggtgcgcgtggaactagaggctgattggctggcccagccctgg
cttgcgaccgtgcgccatactgactttgagcacttgtcactacgccgcgggcagcgctta
ttcgcccacccccgccactggcggcgtttcccaaagtag

DBGET integrated database retrieval system