KEGG   Halothermothrix orenii: Hore_01010Help
Entry
Hore_01010        CDS       T00838                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hor  Halothermothrix orenii
Brite
KEGG Orthology (KO) [BR:hor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hor03012]
    Hore_01010
   03029 Mitochondrial biogenesis [BR:hor03029]
    Hore_01010
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hor04147]
    Hore_01010
Translation factors [BR:hor03012]
 Eukaryotic Type
  Elongation factors
   Hore_01010
 Prokaryotic Type
   Hore_01010
Mitochondrial biogenesis [BR:hor03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Hore_01010
Exosome [BR:hor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Hore_01010
  Exosomal proteins of breast cancer cells
   Hore_01010
  Exosomal proteins of colorectal cancer cells
   Hore_01010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase CbiA
Motif
Other DBs
NCBI-ProteinID: ACL68862
UniProt: B8D0A8
LinkDB All DBs
Position
119180..120373
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITAVLSNLGSAEVMPFDSIDNAPEEKERG
ITIATSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPSIVVFLNKADMVDDEELIELVEMEVRELLNEYEFPGDDVPVIVGSALQALE
NPDPEGEWGKKIIELMEAVDEYIPEPERDKDKPFLMPVEDVFSITGRGTVATGRVERGTL
HPGDEVEIIGIKETQETVVTGVEMFRKLLDEAVAGDNIGALLRGIGRDEIERGQVLAKPG
SITPHTHFKAEVYVLTKEEGGRHTPFFEGYRPQFYFRTTDVTGTISLPEGVEMVMPGDNV
EMEVKLITPIAMEEGLRFAIREGGRTVGAGVVSQIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatttgaaaggacaaaaccgcatgttaatattggaaccataggtcac
gtagaccacggtaagactactttaacagcagcgataacagctgtattatcaaatctgggt
agtgctgaagtaatgccctttgattctatcgataatgcacctgaagaaaaagaaagagga
ataaccattgctacctctcacgttgaatatgagactgctaataggcactatgcccacgtt
gactgtccaggtcatgctgactatgtaaagaatatgattaccggggccgcccagatggac
ggagctattctggtagtatcagcagcagacggaccgatgccccagaccagagaacatatt
cttctggcccgtcaggtaggtgtaccgagcatagttgtctttttaaacaaggccgatatg
gtagatgacgaagagttaattgagctggtagagatggaagtaagggaattattaaatgaa
tatgaattccctggagatgacgtaccggtaatagttggatcagcattacaggctcttgaa
aatcctgatcctgaaggagaatggggtaagaagatcattgaacttatggaagcagtagat
gaatacattcccgaaccagaaagggataaagacaaaccattcttgatgccagtagaagac
gtattcagtattaccggacgtggaacagtagctaccggtagggtagagagaggaacctta
catcccggtgacgaggtagaaattatcgggattaaagagacccaggagaccgtagtaacc
ggggtagagatgttccgtaagttactggatgaagcggtagcaggagataacattggagcc
ctgttaaggggtataggaagagatgagatagaaaggggtcaggtattagccaagccaggg
agtataaccccacatacccacttcaaggctgaggtatatgttctgaccaaagaagaagga
ggaaggcatactccattttttgaaggatacaggccccagttttatttcaggaccacagac
gtaaccgggactatcagcttaccagagggagtagagatggtaatgcccggtgacaatgta
gagatggaagtaaaattaattactcccattgctatggaagaaggattaaggtttgctatc
cgtgaaggtggccgtaccgttggtgccggtgttgtcagccagattattgagtaa

DBGET integrated database retrieval system