KEGG   Halothermothrix orenii: Hore_03240Help
Entry
Hore_03240        CDS       T00838                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
hor  Halothermothrix orenii
Brite
KEGG Orthology (KO) [BR:hor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hore_03240
Enzymes [BR:hor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Hore_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACL69085
UniProt: B8D1K8
LinkDB All DBs
Position
333934..335010
Genome map
AA seq 358 aa AA seqDB search
MVNLPEKMKALVAYAPGDYRFEEVDVPRAGEGEIVVKVEACGICAGDIKAYHGAPSFWGG
EGNPPYIKAPMIPGHEFIGEIVEKGAEVSDDFEIGDRVISEQIVPCWECKFCRTGRYWMC
QKHDVYGFQNNVNGGMAEYMKFPKEAINYKVPKDIPIEKAILIEPYACSKHAVDRANISN
EDVVVLSGAGTLGLGMVGAIKLRNPKSLVVLDLKDDRLELAKKFGADITMNPKKENVVEK
ILEMTDGYGCDIYIEATGHPSSVQQGLEAIRKLGTFVEFSVFGDLVTTDWSIISDRKELD
VLGSHLGPYCYEPVIEWIANGKLPTEGVVTHKFPLEKWKEAFEKAEKGQDSIKVVLVP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacttacccgaaaaaatgaaggcactggtagcttatgctcctggtgattatcga
tttgaggaagtagatgtgcctagggctggagaaggagaaattgttgttaaagtagaagcc
tgtggaatatgtgcaggcgatattaaagcatatcacggagctccaagcttttggggtggt
gaaggtaatccaccatatataaaagccccaatgataccaggtcatgaatttataggagaa
attgttgaaaaaggggctgaagtttcagatgattttgaaataggagacagggtaatttct
gaacaaatagttccttgctgggaatgtaaattttgtagaacagggcgttactggatgtgt
caaaagcatgatgtctatggatttcaaaataatgtaaatggtggtatggctgaatatatg
aaattcccaaaagaggcaataaattataaggttcctaaggatataccaattgaaaaggct
atactcatagaaccatatgcctgttcaaaacatgccgttgatagggctaacattagtaac
gaagatgtagttgtactatcaggggcaggaacactgggattgggtatggtaggagctatt
aagctaaggaatcctaaatcattggtagttctcgatttaaaagatgatagacttgagctt
gctaaaaaatttggagcagacataacaatgaatcccaaaaaagaaaatgttgtagaaaaa
atattggaaatgactgatgggtatggttgtgacatttatatagaagctaccggtcatccc
agtagtgttcaacaagggctagaggctattcggaaacttggtaccttcgttgagtttagt
gtttttggtgatctcgtaaccactgattggagtattataagtgatcggaaagaacttgat
gttttaggttcccatttaggaccatattgttatgaaccggttattgaatggatagctaat
ggtaaattacccacagaaggagtagtcacccataaatttccccttgaaaaatggaaagaa
gcttttgaaaaagcagaaaagggtcaagattcaataaaagtagtgcttgtaccataa

DBGET integrated database retrieval system