KEGG   Halothermothrix orenii: Hore_03410Help
Entry
Hore_03410        CDS       T00838                                 

Definition
(GenBank) DNA polymerase LigD polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
hor  Halothermothrix orenii
Pathway
hor03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hor00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Hore_03410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hor03400]
    Hore_03410
Enzymes [BR:hor01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Hore_03410
DNA repair and recombination proteins [BR:hor03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Hore_03410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ACL69102
UniProt: B8D1M5
LinkDB All DBs
Position
complement(354672..355613)
Genome map
AA seq 313 aa AA seqDB search
MKLTIGKHDVQLTNLDKVLWPELGYTKGDLINYYINMYPYLKEYLLNRPLSMKSYPDGIN
GKSFYQKDCPDYAPHWLSTYGIFSGHRKDIINWVTINKLSDLVWVANRASIELHTWFSTT
TNLDKPDFAVFDLDPGSKSSMKDVVDIALTIKNILDEFNVRSFVKTSGKRGLHVYIPVKT
RYTYKEIRSFLQNVAEMVIKLKPEQATVEWRKNKRQGKVYIDYRQNGKSKTLPAPYSLRP
TSKATVSTPLKWSEITPDLNPDNYNIKNIETRIKQKGNIWETLLKIRQELPGLFLGLLLF
LSFSLFGGLNTFL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcttaccatcggtaaacacgatgttcaattaaccaatcttgataaggtcctatgg
cctgaactgggttatactaaaggtgatttgattaattactatataaatatgtatccctat
cttaaagaatacctcttaaaccgccccctgtccatgaaaagttacccggatggaattaac
ggtaaatcattttatcagaaagactgccccgattatgccccccactggctatccacttat
ggtattttctcgggccatcgaaaggatataataaactgggttactataaacaaactatca
gaccttgtctgggttgctaaccgggcctcaatagaactacatacctggttttcaactacc
actaaccttgataaacctgattttgctgtatttgacctggatcccggatctaaatcatct
atgaaagatgtagttgatatcgccctgaccattaaaaatatcctggatgaatttaatgtc
aggtcatttgtgaaaacctctggcaagaggggacttcatgtttatattcctgttaaaaca
agatacacttataaagaaataagaagcttcctgcaaaatgtagcggaaatggtaatcaaa
ttaaaaccagaacaggctactgtagaatggagaaaaaataagaggcagggtaaggtttat
atagattaccgacagaacggtaaatccaaaacccttcctgccccttattctttaaggccc
accagtaaggccaccgtctctacccctctaaaatggtcagaaataaccccggatctcaat
ccagataattacaatattaaaaatattgaaactagaatcaaacagaagggtaacatctgg
gaaacccttttaaaaatacgccaggaactacccggtctttttcttggtcttcttcttttt
ctttccttctccctcttcggtggcctcaacacttttctttag

DBGET integrated database retrieval system