KEGG   Halothermothrix orenii: Hore_04890
Entry
Hore_04890        CDS       T00838                                 

Definition
(GenBank) Dephospho-CoA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
hor  Halothermothrix orenii
Pathway
hor00770  Pantothenate and CoA biosynthesis
hor01100  Metabolic pathways
hor01240  Biosynthesis of cofactors
Module
hor_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Hore_04890
Enzymes [BR:hor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     Hore_04890
SSDB
Motif
Pfam: CoaE MGS AAA_18 AAA_33 Phage_sheath_1
Other DBs
NCBI-ProteinID: ACL69247
UniProt: B8D220
LinkDB
Position
529858..530811
AA seq 317 aa
MIIGLTGGIASGKSTVSNILKELGACIIDADRIAHKILKKGQPGWRGVVGYFGTDIIDDK
GEIDRKKLGKLVFNKPEERKKLEKITHPIIISQIKDEIVSLKNKCNLIILDAPLLFEANL
DRLVDRVWVVYVDRDIQLRRLQERDGLSREEAILRIETQMPLKEKARLADIVIDNNGSIK
KLKKQVIKHWRELKMKRIALIAHDEKKDDIIEFARKHYDLLKKCKLIATGTTGKMIIDKV
GLEVERMLSGPLGGDQMIGSRVAQEKLDGVIFLRDPLTAQPHEPDITALLRVCDVHNVPL
ATNLATADLILHKLLEE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgataattgggctaaccgggggaattgcctctggtaaaagtacagtaagtaatattttg
aaggaactgggtgcctgtattattgatgctgacaggattgctcataaaatattaaaaaaa
ggccaacctggttggagaggtgttgtcggttactttggtacagatattattgatgataaa
ggtgaaatagatagaaaaaaacttggtaaactggtttttaataaacctgaagaaagaaaa
aaactggaaaaaataacccatccaataattatctcacaaattaaagatgaaatagtttct
ctcaaaaataaatgcaatttaattattcttgatgccccacttttatttgaagccaacctg
gacaggctggtggaccgggtctgggtggtttatgttgatcgggacatacagcttagacgt
ttacaggaacgggatgggcttagccgggaagaagccattttgaggatagaaacccagatg
ccgcttaaagaaaaggccagactggctgatattgttatagataataatgggagtattaaa
aaactaaaaaaacaggtaataaaacactggagggagttaaagatgaagaggatagctttg
attgctcatgatgaaaaaaaagatgatataattgagtttgccagaaaacattatgacctt
ttaaagaaatgtaaacttattgcaaccgggactaccgggaaaatgattattgataaggtt
ggccttgaggttgagagaatgctctctggaccactgggtggcgaccagatgattggctcc
agggtagctcaggagaaactggatggtgtaatctttttacgggatccccttacagcccag
cctcatgaacctgatattacagccctgttaagggtctgtgatgttcataatgtacccctg
gctactaacctggcaacagctgatttgattttgcacaaactactggaagaataa

DBGET integrated database retrieval system