KEGG   Halothermothrix orenii: Hore_18730Help
Entry
Hore_18730        CDS       T00838                                 

Definition
(GenBank) alpha amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
hor  Halothermothrix orenii
Pathway
hor00500  Starch and sucrose metabolism
hor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hore_18730
Enzymes [BR:hor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Hore_18730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1939 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ACL70622
UniProt: B8CZA3
LinkDB All DBs
Position
complement(2001024..2002352)
Genome map
AA seq 442 aa AA seqDB search
MKVFRRRLFIVLFSLLLLISVITSARAGVLMQGFYWDTPYQGEWYDHIASKAEELSNAGF
TAIWFPSPCKGDSGGYSMGYDVFDHYDLGNYYQQGTTETRFGSKNELLNAINAYHSEGMQ
VYVDTVMNHMMGGEQEWNPNTNSYTYTRFDYPHDTFEKNYKHFHPNYTHPDNDPPYHSKE
FGEDVCYYNDYNYMGNGLKNWAAWLKNNIGFDGYRLDFVKGIEPDYIKSWKQTSPMSSSF
VVGEYWDGNRDTLDWWANYTGCHVFDFALFYTLKDMCNSDGYYDMRGLQDAGLVEINPYR
AVTFVENHDTDEHDPVTKNKLMAYAYILTHEGYPTVFWKDYYVYDLKDEINNLVWIHENL
ASGTTSNLYADDSLYIAQRNGNPGLVVGLNDSSSWKSKWVQTKWSNVTLHDYTGQAGDVY
VDSNGWVEISIPPKGYSVYSPY
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttttagaaggcgtcttttcattgttttgttcagtctgcttctgttgatttca
gttattacttctgcaagggccggggtgttgatgcaagggttttactgggatactccatat
cagggagagtggtatgaccatatagcctccaaagctgaagaactttcaaatgctggattt
actgcaatatggtttccttcgccatgtaaaggtgatagtggcggttattccatgggttat
gacgtttttgatcattatgacctggggaattattaccagcaggggactactgaaacccga
tttgggagtaaaaatgaactgttaaatgcaatcaatgcttaccacagtgaaggaatgcag
gtgtatgttgatactgtcatgaaccacatgatgggtggtgaacaggaatggaatccgaat
acaaattcgtatacatataccaggtttgattacccccacgatacttttgaaaagaattat
aaacattttcatccaaattatacccacccagataatgaccccccttatcatagtaaagaa
tttggcgaagatgtctgttattataatgactataactatatggggaatgggttaaaaaat
tgggcagcctggttaaagaataatattggatttgatgggtatagattagattttgttaaa
ggtatagaacctgattatattaaatcctggaaacaaacttctccaatgagtagtagtttt
gtcgtgggtgaatactgggatggtaacagggataccctggattggtgggcaaattatact
ggttgtcatgtttttgactttgcattattttacacattaaaagatatgtgtaatagcgac
ggctactatgatatgagagggctacaggatgcagggttggtggaaataaacccttacagg
gcggtaacatttgtagaaaaccatgatacagatgaacatgacccggtaacaaaaaataaa
ttaatggcctatgcttatattttaacccatgagggttatcctacagtattttggaaagat
tattatgtatatgatttaaaggatgaaataaataacctggtctggatacatgagaacctg
gcctcaggaactaccagtaatctttacgctgatgatagtttgtatattgcccaacgaaat
ggtaatcccggacttgtggtcgggctcaacgatagttccagttggaagagtaaatgggtt
caaactaaatggagtaatgttactttacatgactataccggacaggccggagatgtatat
gtggatagtaacggctgggtagaaatttcaataccaccaaaaggatatagtgtctactct
ccatattaa

DBGET integrated database retrieval system