KEGG   Glaesserella parasuis KL0318: JT17_02700Help
Entry
JT17_02700        CDS       T03312                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hpak  Glaesserella parasuis KL0318
Pathway
hpak00240  Pyrimidine metabolism
hpak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpak00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    JT17_02700
Enzymes [BR:hpak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     JT17_02700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 AAA_30
Motif
Other DBs
NCBI-ProteinID: AIK89725
LinkDB All DBs
Position
complement(529003..529581)
Genome map
AA seq 192 aa AA seqDB search
MAKLYFYYSAMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRYGVGKVSSRIGISQDAR
LFKNDSNLFDEITAYIADEKLHCILIDEAQFLTKQQVYQLTEVVDKLKIPVLCYGLRTDF
QSELFEGSRYLLAWADQLEELKTICYCGRKAGFVIRMNEKGEAVKDGDQIQIGGNDSYLS
VCRLHYKEKLGI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactctatttttattactctgcgatgaatgcagggaaatccacaactttgctt
caatcatcttataactatcaagaacgaggaatgaatacccttgtttatactgcggcgata
gatgatcgttatggcgtagggaaagtctcctctcgaattggtatttcacaagatgctcgt
ttattcaaaaacgatagcaatttatttgatgaaatcaccgcttacattgccgatgaaaaa
ttgcactgtattctgattgatgaagcacaatttcttaccaagcaacaggtttatcaactg
actgaagtggtcgataaattaaaaatccctgtgctttgttacggcttacgcaccgatttc
caatctgaattatttgagggaagtcgctatctacttgcttgggctgatcagctcgaagaa
ctcaaaaccatctgttattgtgggcgtaaagcaggctttgttattcgtatgaatgagaaa
ggcgaagcggtaaaagatggagatcaaatccaaattggtggaaacgatagctatctttct
gtatgccgtttgcattataaggaaaaattggggatataa

DBGET integrated database retrieval system