KEGG   Glaesserella parasuis KL0318: JT17_03000Help
Entry
JT17_03000        CDS       T03312                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hpak  Glaesserella parasuis KL0318
Pathway
hpak00473  D-Alanine metabolism
hpak00550  Peptidoglycan biosynthesis
hpak01100  Metabolic pathways
hpak01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    JT17_03000
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JT17_03000
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    JT17_03000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpak01011]
    JT17_03000
Enzymes [BR:hpak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     JT17_03000
Peptidoglycan biosynthesis and degradation proteins [BR:hpak01011]
 Precursor biosynthesis
  Amino acid ligase
   JT17_03000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 R2K_2 ATP-grasp_3 ATPgrasp_Ter ATPgrasp_ST GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AIK89779
LinkDB All DBs
Position
complement(587587..588498)
Genome map
AA seq 303 aa AA seqDB search
MSLKNEKIAVLFGGVSAEREISLNSGKSVFEALQSLGYNVEAIDTKEFPIEKLKEKGIQR
VFNILHGGIGENGVLQGALEQLGIPYTGCGVMASAITLDKFRTKLLWNAVGLPTAAMEVV
RRGQAVNSDEIIAKLGLPLFVKPASEGSSVGVSKVKTAEQLLPAIEEALKYDSIVLVEEN
LAGAEYSVPVLDGEVLPAVQIIPDGEFYDYHAKYISDNTQYVVPALNADRQAEVAKLVKQ
AYDVVGCRGWSRIDVMEDGEGNFRLVEVNTCPGMTSHSIFPKSAATVGYSFERLVERVLE
LSA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaaaaacgaaaaaattgcggtgttatttggtggcgtttcagcagaacgtgaa
atttcgctcaattcaggcaaatcggtgtttgaagcattacaaagtttaggttataacgtt
gaagcgattgatacaaaagaatttccgattgaaaaattaaaagaaaaaggcattcagcgt
gtatttaatattcttcacggtggtattggtgaaaatggcgtgcttcaaggggcgttagag
caactcggtattccctatacaggctgtggcgtaatggcttcggcgattactttagataag
ttccgcaccaagctattgtggaatgcagtgggcttaccaacagcggcaatggaagtggta
cgccgtgggcaagcggtcaactccgatgaaattattgcaaaattaggtttaccattattt
gtgaaacctgcgagtgaaggctcaagtgttggcgtaagcaaagtgaaaaccgcagaacag
ttattacctgcaatcgaagaagcattaaaatatgattcaattgtgttggtggaagaaaat
ttagcaggggcggaatactctgtgccagtacttgatggtgaagtgttgcctgcggtgcaa
attattccagacggcgagttttatgactaccacgcaaaatatatttcggataatacccag
tatgttgtgccagcgttaaatgctgatcgccaagcggaagtcgctaagttagtgaaacag
gcttatgatgtggtgggctgtcgtggttggagccgaattgatgtaatggaagatggcgaa
ggaaacttccgtttagttgaagtgaatacttgcccaggtatgaccagtcatagtattttc
ccaaaatcagcggcgactgtgggttatagtttcgagcgtttagttgagcgtgtattggag
ttaagtgcgtaa

DBGET integrated database retrieval system