KEGG   Glaesserella parasuis KL0318: JT17_03930Help
Entry
JT17_03930        CDS       T03312                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
hpak  Glaesserella parasuis KL0318
Pathway
hpak00061  Fatty acid biosynthesis
hpak01100  Metabolic pathways
hpak01212  Fatty acid metabolism
Module
hpak_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hpak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JT17_03930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hpak01004]
    JT17_03930
Enzymes [BR:hpak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     JT17_03930
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     JT17_03930
Lipid biosynthesis proteins [BR:hpak01004]
 Fatty acid synthase
  Component type
   JT17_03930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AIK89951
UniProt: A0A084EXN9
LinkDB All DBs
Position
complement(781531..782061)
Genome map
AA seq 176 aa AA seqDB search
MNTCTPNIKSSYDYNDLLASGRGELFGSEGPQLPAPSMLMMDRITKITDKEGLFEKGYIE
AELDINQDLPFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWVGGKGKGRALGVGEVKFTG
QILPTAKKVIYRINMKRVINRKLVMGLADGEVEVDGRIIYTATDLKVGLFQDTTSF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttgtacacctaacatcaaatcaagttatgattacaacgatcttttagcgtca
ggacgaggcgaactttttggtagcgaaggtccacaactgccagcaccgtcaatgttgatg
atggacagaattaccaaaatcaccgacaaagaaggtctgtttgagaaagggtatattgaa
gcggaattagatattaaccaagatctgcctttctttggctgtcactttatcggcgatcct
gtaatgccgggttgcttaggcttagacgcaatgtggcaactggttggcttttacttaggc
tgggtcggcggtaaaggcaagggcagagccttaggggttggcgaagtgaaatttacaggg
caaattctaccgactgccaaaaaagtgatttatcgtatcaatatgaaacgtgtgatcaac
cgtaagctcgtgatggggcttgctgatggcgaagtcgaagttgatggcagaattatctat
actgccacagacttaaaagtaggtctattccaagatacaacatctttctaa

DBGET integrated database retrieval system