KEGG   Glaesserella parasuis KL0318: JT17_08875Help
Entry
JT17_08875        CDS       T03312                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
hpak  Glaesserella parasuis KL0318
Pathway
hpak00290  Valine, leucine and isoleucine biosynthesis
hpak01100  Metabolic pathways
hpak01110  Biosynthesis of secondary metabolites
hpak01130  Biosynthesis of antibiotics
hpak01210  2-Oxocarboxylic acid metabolism
hpak01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JT17_08875
   00290 Valine, leucine and isoleucine biosynthesis
    JT17_08875
   00220 Arginine biosynthesis
    JT17_08875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpak01007]
    JT17_08875
Enzymes [BR:hpak01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     JT17_08875
    2.6.1.66  valine---pyruvate transaminase
     JT17_08875
Amino acid related enzymes [BR:hpak01007]
 Aminotransferase (transaminase)
  Class I
   JT17_08875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIK90787
UniProt: A0A084F0Z4
LinkDB All DBs
Position
1768564..1769781
Genome map
AA seq 405 aa AA seqDB search
MERFAKTDKLAHVRYDIRGPIHKEATRLEEEGHKILKLNIGNPAPFGFEAPAEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQYYQLKGMRDLDVGDVYIGNGVSELITMSMQALLNDGD
EILIPMPDYPLWTAAATLAGGKAVHYLCDEENEWFPDIEDIKSKITPRTKAILVINPNNP
TGAVYSRQLLLDIVAIAREHNLIIFSDEIYEKIVYDGAVHHHLAPLAPDLLTVTYNGLSK
AYRVAGFRQGWMVLNGPKNQAKGFIEGLDMLASMRLCANTPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNKAHELLTKIPGISCVKPKGAMYMFPKIDTEMYGIKDDQKFVYDLLQQEK
VLLVQGSGFNWHKPDHFRVVTLPYVDQLEEAIGRLAKFLQSYRQD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttttgcaaaaaccgataaattagctcacgtccgctacgatattcgtgggcct
atacataaggaagcgacccgtctggaagaagaaggacataagattttaaaattaaacatt
ggtaacccagccccattcggttttgaagcccctgcggaaattttagttgatgttattcgt
aacttaccaaccgctcaaggctattgcgactctaagggtttgtactctgctcgtaaggcg
attgtgcaatattatcaattaaaaggtatgcgtgatttagatgtcggtgatgtttacatt
ggtaacggcgtatctgaactcatcacaatgtcaatgcaagccttgttaaatgatggcgat
gagattttaattccgatgccagattatccactttggacagcggcggcaacccttgcaggc
ggtaaagcggttcattacctttgcgatgaagaaaatgagtggtttccagatattgaagat
attaaatcgaaaatcaccccaagaaccaaagcaattttggtgattaacccgaataaccca
acgggagcagtgtatagccgtcagttattattggatattgtggcgattgcccgtgaacat
aacttgattattttctcagacgaaatttacgagaaaattgtctatgacggtgcggtacat
catcatcttgcccctcttgcccctgatcttttaacggtgacttataatggtttgtcaaag
gcataccgtgtggcaggtttccgtcaaggttggatggtgttaaacggcccgaaaaatcag
gcaaaaggctttattgaaggcttagatatgcttgcgtcaatgcgtttatgtgccaacacc
ccgatgcaacacgctattcaaacagcgttaggcggttatcaaagcattaacgaatttatc
ttaccgggtggtcgtttattggaacaacgtaataaggctcacgaattgctcaccaaaatc
cctgggattagctgtgtgaagccaaaaggggcgatgtatatgttcccgaaaattgatacg
gaaatgtacggtatcaaagacgatcaaaaatttgtttacgatctgcttcaacaggaaaaa
gtgttgctggttcaaggctcaggctttaactggcataaaccagaccacttccgtgtggtg
acattgccgtatgtggatcaactggaagaagctattggtcgattagcgaaattcttacag
agttatcgtcaagattaa

DBGET integrated database retrieval system