KEGG   Glaesserella parasuis KL0318: JT17_08875Help
Entry
JT17_08875        CDS       T03312                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
hpak  Glaesserella parasuis KL0318
Pathway
hpak00220  Arginine biosynthesis
hpak00250  Alanine, aspartate and glutamate metabolism
hpak00290  Valine, leucine and isoleucine biosynthesis
hpak01100  Metabolic pathways
hpak01110  Biosynthesis of secondary metabolites
hpak01130  Biosynthesis of antibiotics
hpak01210  2-Oxocarboxylic acid metabolism
hpak01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JT17_08875
   00290 Valine, leucine and isoleucine biosynthesis
    JT17_08875
   00220 Arginine biosynthesis
    JT17_08875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpak01007]
    JT17_08875
Enzymes [BR:hpak01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     JT17_08875
    2.6.1.66  valine---pyruvate transaminase
     JT17_08875
Amino acid related enzymes [BR:hpak01007]
 Aminotransferase (transaminase)
  Class I
   JT17_08875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIK90787
UniProt: A0A084F0Z4
LinkDB All DBs
Position
1768564..1769781
Genome map
AA seq 405 aa AA seqDB search
MERFAKTDKLAHVRYDIRGPIHKEATRLEEEGHKILKLNIGNPAPFGFEAPAEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQYYQLKGMRDLDVGDVYIGNGVSELITMSMQALLNDGD
EILIPMPDYPLWTAAATLAGGKAVHYLCDEENEWFPDIEDIKSKITPRTKAILVINPNNP
TGAVYSRQLLLDIVAIAREHNLIIFSDEIYEKIVYDGAVHHHLAPLAPDLLTVTYNGLSK
AYRVAGFRQGWMVLNGPKNQAKGFIEGLDMLASMRLCANTPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNKAHELLTKIPGISCVKPKGAMYMFPKIDTEMYGIKDDQKFVYDLLQQEK
VLLVQGSGFNWHKPDHFRVVTLPYVDQLEEAIGRLAKFLQSYRQD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttttgcaaaaaccgataaattagctcacgtccgctacgatattcgtgggcct
atacataaggaagcgacccgtctggaagaagaaggacataagattttaaaattaaacatt
ggtaacccagccccattcggttttgaagcccctgcggaaattttagttgatgttattcgt
aacttaccaaccgctcaaggctattgcgactctaagggtttgtactctgctcgtaaggcg
attgtgcaatattatcaattaaaaggtatgcgtgatttagatgtcggtgatgtttacatt
ggtaacggcgtatctgaactcatcacaatgtcaatgcaagccttgttaaatgatggcgat
gagattttaattccgatgccagattatccactttggacagcggcggcaacccttgcaggc
ggtaaagcggttcattacctttgcgatgaagaaaatgagtggtttccagatattgaagat
attaaatcgaaaatcaccccaagaaccaaagcaattttggtgattaacccgaataaccca
acgggagcagtgtatagccgtcagttattattggatattgtggcgattgcccgtgaacat
aacttgattattttctcagacgaaatttacgagaaaattgtctatgacggtgcggtacat
catcatcttgcccctcttgcccctgatcttttaacggtgacttataatggtttgtcaaag
gcataccgtgtggcaggtttccgtcaaggttggatggtgttaaacggcccgaaaaatcag
gcaaaaggctttattgaaggcttagatatgcttgcgtcaatgcgtttatgtgccaacacc
ccgatgcaacacgctattcaaacagcgttaggcggttatcaaagcattaacgaatttatc
ttaccgggtggtcgtttattggaacaacgtaataaggctcacgaattgctcaccaaaatc
cctgggattagctgtgtgaagccaaaaggggcgatgtatatgttcccgaaaattgatacg
gaaatgtacggtatcaaagacgatcaaaaatttgtttacgatctgcttcaacaggaaaaa
gtgttgctggttcaaggctcaggctttaactggcataaaccagaccacttccgtgtggtg
acattgccgtatgtggatcaactggaagaagctattggtcgattagcgaaattcttacag
agttatcgtcaagattaa

DBGET integrated database retrieval system