KEGG   Hafnia paralvei: AL518_02865Help
Entry
AL518_02865       CDS       T05667                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hpar  Hafnia paralvei
Pathway
hpar00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hpar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AL518_02865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpar02000]
    AL518_02865
Enzymes [BR:hpar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AL518_02865
Transporters [BR:hpar02000]
 Other Transporters
  Pores ion channels [TC:1]
   AL518_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2 GST_N_4 Tom37 Colicin_K
Motif
Other DBs
NCBI-ProteinID: AMH17073
UniProt: A0A2A2M7I4
LinkDB All DBs
Position
630808..631476
Genome map
AA seq 222 aa AA seqDB search
MITVHHLNNSRSHRVLWTLEELGLPYQIEQYQRDPVTMLAPESLKKIHPLGKAPVMTDGE
WTIAESAAILEYLQDTYDHSALLKPQDKPERMQYRYWLHYAEGSLMPLLVMKLIFNRLGK
APVPWIIRPIGSLLGKGVQRGYLDQQLATHLRFIENHLSKNNWFAGDHFSLADIQMSFPL
EAMNIRTGLDKAPHARGLLKRLHARPAYLRALEKGGPLELMD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattacggtccatcatcttaataattcgcgttcacaccgggtgctttggacgcttgaa
gagctgggattaccctatcagatcgaacagtatcaacgcgatcccgtaaccatgctggct
cctgaatcgttgaaaaaaatccatccgttgggaaaggctcccgtgatgaccgatggcgaa
tggacaattgcggagtccgctgccattctcgaatatctgcaagatacttatgaccactcc
gcactgctcaaaccgcaggataagccagaacggatgcagtaccgctactggctgcactat
gccgaaggatcattaatgccattattggtaatgaagttgatttttaatcgactagggaag
gctccagtgccttggatcattcggccaattggcagcctgttaggtaaaggtgtgcagcgt
ggttaccttgatcagcaactggcaacgcatttgcgcttcattgaaaatcacctgagtaaa
aataactggtttgctggtgaccactttagtctggcagatatacagatgagttttcccttg
gaagcaatgaatatacgcacgggattggataaggccccacatgcacgggggttattgaag
cgtttacacgcgagacctgcctatttgcgcgcattagaaaaaggtgggccgttagaatta
atggactaa

DBGET integrated database retrieval system