KEGG   Hafnia paralvei: AL518_05685Help
Entry
AL518_05685       CDS       T05667                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hpar  Hafnia paralvei
Pathway
hpar00250  Alanine, aspartate and glutamate metabolism
hpar00410  beta-Alanine metabolism
hpar00430  Taurine and hypotaurine metabolism
hpar00650  Butanoate metabolism
hpar01100  Metabolic pathways
hpar01110  Biosynthesis of secondary metabolites
hpar01120  Microbial metabolism in diverse environments
hpar02024  Quorum sensing
Module
hpar_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AL518_05685
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL518_05685
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AL518_05685
   00430 Taurine and hypotaurine metabolism
    AL518_05685
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AL518_05685
Enzymes [BR:hpar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AL518_05685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AMH17544
UniProt: A0A370W5H5
LinkDB All DBs
Position
1273556..1274956
Genome map
AA seq 466 aa AA seqDB search
MAKKEVADFRSELLDSRFGSEAIRNISEGKIFPKDEMREDVAFQIISDELFLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMMADLWNAPVPANGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTNKPNLVCGPVQICWHKFARYWDVELREI
PMQPGQLFMDPKRMVEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKLQAETGLDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEAALPEELV
FKVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQSASYQVAGYLADAIAKL
GPYEFICSGGPEEGIPAVCFRVKEGANPGYTLLDLSERLRLRGWQVPAFTLSGEMSDVVV
MRIMCRRGFEMDFAELLLEDFKASLKYLSEHPSLQGIATQNSFNHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaagaagtagcggattttcgctcagagctattagattcccgctttggttca
gaagcgattcgtaatatttctgagggaaaaattttccctaaagacgaaatgcgtgaggat
gttgcatttcaaatcattagcgatgaactgtttcttgatgggaatgcccgtcagaacttg
gccacgttttgccaaacgtgggatgacgataatgttcataagttaatggacttatcgatc
aataaaaactggatcgacaaagaggaatacccacagtctgcagccatcgatctacgctgc
gtgaacatgatggcagacctgtggaatgcgccggtacccgcaaatggccaagcggtcggt
accaacactatcggttcttccgaggcctgtatgttgggcggtatggcgatgaaatggcgc
tggcgtaaacgtatggaggctgcgggtaaaccaacgaacaagccgaatttggtttgtggc
cctgttcagatttgctggcataaatttgcacgctactgggatgtcgagctgcgtgaaatt
cctatgcagccgggtcagttgtttatggatccaaaacgtatggtggaagcctgtgatgag
aataccattggcgtcgtaccgacgtttggcgtgacctataccggcaactatgaattccct
cagccgctacatgatgcgctggataaacttcaggcggagactggtcttgatattgatatg
catatcgatgccgccagcggtggctttttggcgcctttcgttgcaccggatatcgtgtgg
gatttccgtttacctcgggttaaatccatcagcgcctcgggtcataagtttggtcttgct
ccccttggctgtggctgggtgatctggcgtgatgaggccgcgttgccagaggaactggtg
tttaaagtggattatttgggcggacaaattggcacgttcgcaattaatttctctcgtcca
gcaggtcaggttattgcgcaatattatgagtttttgcgtttgggacgagaaggttacacc
aaggtgcaaagcgcctcttatcaagtcgctggttacttagccgatgctatcgccaaatta
ggaccatatgaatttatctgctctggcggtcctgaagagggcattcctgcggtatgtttc
cgtgtgaaagagggcgcgaatccgggttataccctgctcgatctctctgaacgtttacga
ctacggggttggcaggtacctgcgtttactctgagcggtgagatgtccgacgttgtagtg
atgcgcattatgtgccgccgtggttttgagatggactttgccgaattgctgcttgaggac
tttaaagcttcgctgaaatacctcagtgagcacccatctctgcagggcattgcgactcag
aatagctttaatcacacataa

DBGET integrated database retrieval system