KEGG   Hafnia paralvei: AL518_08045Help
Entry
AL518_08045       CDS       T05667                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
hpar  Hafnia paralvei
Pathway
hpar00250  Alanine, aspartate and glutamate metabolism
hpar00280  Valine, leucine and isoleucine degradation
hpar00310  Lysine degradation
hpar00410  beta-Alanine metabolism
hpar00640  Propanoate metabolism
hpar00650  Butanoate metabolism
hpar01100  Metabolic pathways
hpar01120  Microbial metabolism in diverse environments
Module
hpar_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AL518_08045
   00650 Butanoate metabolism
    AL518_08045
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL518_08045
   00280 Valine, leucine and isoleucine degradation
    AL518_08045
   00310 Lysine degradation
    AL518_08045
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AL518_08045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpar01007]
    AL518_08045
Enzymes [BR:hpar01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AL518_08045
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AL518_08045
    2.6.1.48  5-aminovalerate transaminase
     AL518_08045
Amino acid related enzymes [BR:hpar01007]
 Aminotransferase (transaminase)
  Class III
   AL518_08045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMH17967
UniProt: A0A370W435
LinkDB All DBs
Position
1805799..1807082
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRGNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNKRVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVFRALYPCELHGVSD
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYSASPDFMKRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQLGVAADITTFAKSIAGGFPLAGVTGKAEVMDAIAPGGLGGTYAG
SPIACAAALAVLDTFDEENLLQRANDVGQKLKEGLLSIAETHREIGDVRGLGAMIAIELF
EDGDVHKPNAKLTAEVVARARDKGLILLSCGPYYNVLRILVPLTVSDAQIKQGLDIIAEC
FTEAKKN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaataaagagttgatgcagcgccgcggcaacgccgttccacgcggagtgggg
cagatccatcccatttttgccgagcgtgcagaaaattgccgcgtatgggacgttgaaggg
cgtgagtatctcgattttgcaggcggaattgcggtgctgaacactggccatttgcatcct
aaagtcgtcgctgcggtggaagctcaactgaaaaagttgtcgcatacctgtttccaggtt
ctcgcctatgagccttatctggagctgtgcgagatcatgaataaacgcgtgcctggagat
ttcgccaagaaaacgcttctggtgacgacggggtcagaggcggttgaaaacgcagtgaaa
atcgctcgcgccgccacaaagcgtagcggcaccattgcttttagcggggcatatcatggg
cgtacccactataccttatcgctcaccggtaaggtgaacccgtattctgcggggatgggc
ttaatgccaggccacgtatttcgcgcgctgtacccgtgtgagttacacggtgtgagcgac
gatgatgccatcgccagtattcatcgcatcttcaaaaatgacgcagcgccggaagatatt
gcggcgattgtcattgaacccgtacaaggggaaggtgggttctactctgcttcgccggac
tttatgaagcgcttacgggccctgtgcgatgagcacgggattatgctgatagccgatgaa
gtgcaaagtggggcaggacgtaccggtacgctgtttgcaatggaacagttgggcgttgcc
gccgatatcacgactttcgctaaatctatcgcaggggggttccctctcgcgggcgtaacg
ggtaaagctgaagtcatggacgccattgcgccgggaggattaggcggaacttatgcgggg
agcccgattgcctgcgctgctgcgcttgccgtgctcgacactttcgatgaggaaaacctg
ctacagcgcgccaacgatgtcggtcaaaagctgaaagaaggcttattaagtatcgcagaa
acgcatcgtgaaattggtgatgtacgtggtttgggcgccatgattgctatcgagttgttt
gaagacggcgacgtccataaacctaatgccaaattgacggctgaagtggtggcgagagcg
cgtgacaaagggttaatcctgctgtcatgtgggccgtattacaacgtgctacgtattttg
gttccgttgacggtaagcgacgcacagattaagcaagggttggatattattgctgaatgt
tttactgaggctaagaagaattaa

DBGET integrated database retrieval system