KEGG   Hafnia paralvei: AL518_16810Help
Entry
AL518_16810       CDS       T05667                                 

Definition
(GenBank) peptidoglycan glycosyltransferase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
hpar  Hafnia paralvei
Pathway
hpar00550  Peptidoglycan biosynthesis
hpar01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hpar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL518_16810
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AL518_16810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpar01011]
    AL518_16810
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hpar03036]
    AL518_16810
Enzymes [BR:hpar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AL518_16810
Peptidoglycan biosynthesis and degradation proteins [BR:hpar01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AL518_16810
Chromosome and associated proteins [BR:hpar03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    AL518_16810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AMH19528
UniProt: A0A2A2MI32
LinkDB All DBs
Position
3745592..3747364
Genome map
AA seq 590 aa AA seqDB search
MRKRSPLNPRGNYFQGRFVLICLGIVVFLALLLGRVGYLQLMNHPQLEREADQRSLRSLV
TQPLRGTITDREGQPLAVSVASNDVIADPIHVLERDPNLTSEQWSYLSTALSQPESDIKA
KILDNAHRHFIYLGRQVESGIAEYVNKLHIYGISTPSDSSRYYPMSDAASNLIGIVGLDQ
QGLDGIESGFNNLLQGKPGHRVYRKDRYGNVVSLMEDDPAQQAPTLSLSIDRYLQYALYS
HLREGVLLNKADSGAAVLVDVNTGEILGMASYPSYNPNNYQGVPQKDMRNVAISDSFEPG
STVKPLVVMAGLARHLIRPDSVIDTTPYPVNGHLIKDVGHWSRLTITGILQKSSDIGVSH
IALAMPSDVLVNLYHSFGLGVSTGLGIGGESSGYFPLHRERWSDIERATFSFGYGLRVTP
LQMAREYATIGSFGIFRPVSITKVTPPVLGTRVMDENIVRTVVHMMESDALPGGSGVTAA
VPGYRLAIKTGTAEKMGDSGKYDGGYVNYTAGVAPASDPRVALVVMVNHPNAGKHFGGSV
AGPIFGQIMGDVLRHMNIPPDALTDQQSINLNNQMLSHNVQGINTQHKGA
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaagaagtccattgaatccgcgtggcaattattttcaggggcgttttgttcta
atttgcttgggtattgtcgtttttctagccctacttcttggtcgagttggttacttgcag
ttaatgaatcaccctcagttagagcgtgaggccgatcagcgttcactacgttcattggtg
actcaacctttacgtggaacgattaccgatcgcgaagggcaacctttagcggtcagcgtg
gcgtcaaatgatgttattgccgatcctatccatgtcttagagcgcgatcctaacctaacc
agtgagcaatggtcgtatctcagcacggcgctttcacagccagaaagtgatatcaaggca
aagatactcgataacgcgcatcgccactttatctatcttggccgccaggttgaatccggt
attgcggaatatgttaacaagcttcatatatatggaatatccacgccgtctgactccagc
cgttattatccgatgagcgatgcagcctctaatcttatcggtatcgttggattagatcag
caaggcttagacggtatagagagtggttttaacaaccttttgcaagggaaacctgggcat
cgcgtttatcgtaaagatcgttatggcaacgtcgttagccttatggaagacgatccggca
cagcaagcccctacgctcagcctcagcatcgaccgttacctgcaatacgcgctttactca
cacctacgcgaaggcgttttgctgaataaagccgattccggcgcggcagtgttggtggat
gttaataccggtgaaattttagggatggcgagttatccctcttataatccgaataattac
caaggcgtgccgcaaaaggatatgcgcaacgtggcgatatccgatagtttcgagccaggt
tcaacggttaaacccttggtggtgatggctggattggcacgccatctgattcgtcctgat
tccgttatcgatacgacgccatatcccgtcaacgggcatttgatcaaggacgttgggcac
tggtcgcgcctcacgattaccggtatcttgcaaaaatcgagtgacatcggagtatcacac
attgcactggctatgccttctgacgtgctcgtgaatctctatcatagctttgggctaggt
gtttccaccggacttgggattggaggagaaagtagcggttattttccactgcatcgcgaa
cgctggtctgatatcgaacgcgctacattctctttcggctatggtttgcgtgtcactcct
ctacaaatggcgcgtgaatacgccactatcggctcctttggtattttccgtccagtttca
attaccaaagtcacacctcctgttctgggaacgcgagtgatggatgagaacatcgttcgc
accgtagtccatatgatggaaagtgatgctttaccgggtggcagcggcgtgactgcagct
gtgccaggctaccgtttagccataaaaaccggtactgcagaaaaaatgggggacagcgga
aagtatgacggcggctacgtgaactacaccgcgggcgtcgccccagcaagcgatccgcgc
gttgcactggttgtaatggtaaaccatccaaatgcaggaaagcacttcggcggctcggtg
gctgggccgatatttggtcaaatcatgggggatgttttacgccatatgaatatcccacct
gatgcattaaccgaccaacagtcgattaatttaaataaccaaatgttgtcacataacgta
caaggaattaacacccaacataagggcgcttaa

DBGET integrated database retrieval system