KEGG   Glaesserella parasuis SH03: JL26_11075Help
Entry
JL26_11075        CDS       T03301                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
hpas  Glaesserella parasuis SH03
Pathway
hpas00220  Arginine biosynthesis
hpas00250  Alanine, aspartate and glutamate metabolism
hpas00290  Valine, leucine and isoleucine biosynthesis
hpas01100  Metabolic pathways
hpas01110  Biosynthesis of secondary metabolites
hpas01130  Biosynthesis of antibiotics
hpas01210  2-Oxocarboxylic acid metabolism
hpas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JL26_11075
   00290 Valine, leucine and isoleucine biosynthesis
    JL26_11075
   00220 Arginine biosynthesis
    JL26_11075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpas01007]
    JL26_11075
Enzymes [BR:hpas01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     JL26_11075
    2.6.1.66  valine---pyruvate transaminase
     JL26_11075
Amino acid related enzymes [BR:hpas01007]
 Aminotransferase (transaminase)
  Class I
   JL26_11075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIK18234
UniProt: A0A084F0Z4
LinkDB All DBs
Position
2168827..2170044
Genome map
AA seq 405 aa AA seqDB search
MERFAKTDKLAHVRYDIRGPIHKEATRLEEEGHKILKLNIGNPAPFGFEAPAEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQYYQLKGMRDLDVGDVYIGNGVSELITMSMQALLNDGD
EILIPMPDYPLWTAAATLAGGKAVHYLCDEENEWFPDIEDIKSKITPRTKAILVINPNNP
TGAVYSRQLLLDIVAIAREHNLIIFSDEIYEKIVYDGAVHHHLAPLAPDLLTVTYNGLSK
AYRVAGFRQGWMVLNGPKNQAKGFIEGLDMLASMRLCANTPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNKAHELLTKIPGISCVKPKGAMYMFPKIDTEMYGIKDDQKFVYDLLQQEK
VLLVQGSGFNWHKPDHFRVVTLPYVDQLEEAIGRLAKFLQSYRQD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctttgcaaaaaccgataaattagctcacgtccgctacgatattcgtgggcct
atacataaggaagcgacccgtctggaagaagaagggcataagattttaaaattaaacatt
ggtaacccagccccattcggttttgaagcccctgcggaaattttagttgatgttattcgt
aacttaccaaccgctcaaggctattgcgactctaagggtttgtactctgctcgtaaggcg
attgtgcaatattatcaattaaaaggtatgcgtgatttagatgtcggtgatgtttacatt
ggtaacggcgtatctgaactcatcacaatgtcaatgcaagccttgttaaatgatggcgat
gagattttaattccgatgccagattatccactttggacagcggcggcaacccttgcaggc
ggtaaagcggttcattatctttgcgatgaagaaaatgagtggttcccagatattgaagat
attaaatcgaaaatcaccccaagaaccaaagcaattttggtgattaacccgaataaccca
acgggagcagtgtatagccgtcagttattattggatattgtggcgattgcccgtgaacat
aacttgattattttctcagacgaaatttacgagaaaattgtctatgacggtgcggtacat
catcatcttgcccctcttgcccctgatcttttaacggtgacttataatggtttgtcaaag
gcataccgtgtggcaggtttccgtcaaggttggatggtgttaaacggtccgaaaaatcag
gcaaaaggctttattgaaggcttagatatgcttgcgtcaatgcgtttatgtgccaacacc
ccgatgcaacacgctattcaaacagcgttaggcggttatcaaagcattaacgaatttatc
ttaccgggtggtcgtttattggaacaacgtaataaggctcacgaattgctcaccaaaatc
ccagggattagctgtgtgaaaccaaaaggggcgatgtatatgttcccgaaaattgatacg
gaaatgtacggtatcaaagacgatcaaaaatttgtttacgatctgcttcaacaggaaaaa
gtgttgctggttcaaggctcaggctttaactggcataaaccagaccacttccgtgtggtg
acattgccgtatgttgatcagctggaagaagcgattggacgattagcgaagtttttgcag
agttatcgtcaggattaa

DBGET integrated database retrieval system