KEGG   Glaesserella parasuis ZJ0906: K756_00375Help
Entry
K756_00375        CDS       T02697                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00220  Arginine biosynthesis
hpaz00250  Alanine, aspartate and glutamate metabolism
hpaz00290  Valine, leucine and isoleucine biosynthesis
hpaz01100  Metabolic pathways
hpaz01110  Biosynthesis of secondary metabolites
hpaz01130  Biosynthesis of antibiotics
hpaz01210  2-Oxocarboxylic acid metabolism
hpaz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    K756_00375
   00290 Valine, leucine and isoleucine biosynthesis
    K756_00375
   00220 Arginine biosynthesis
    K756_00375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpaz01007]
    K756_00375
Enzymes [BR:hpaz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     K756_00375
    2.6.1.66  valine---pyruvate transaminase
     K756_00375
Amino acid related enzymes [BR:hpaz01007]
 Aminotransferase (transaminase)
  Class I
   K756_00375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 16166526
NCBI-ProteinID: AGO15360
LinkDB All DBs
Position
75951..77168
Genome map
AA seq 405 aa AA seqDB search
MERFAKTDKLAHVRYDIRGPIHKEATRLEEEGHKILKLNIGNPAPFGFEAPAEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQYYQLKGMRDLDVGDVYIGNGVSELITMSMQALLNDGD
EILIPMPDYPLWTAAATLAGGKAVHYLCDEENEWFPDIEDIKSKITPRTKAILVINPNNP
TGAVYSRQLLLDIVAIAREHNLIIFSDEIYEKIVYDGAVHHHLAPLAPDLLTVTYNGLSK
AYRVAGFRQGWMVLNGPKNQAKGFIEGLDMLASMRLCANTPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNKAHELLTKIPGISCVKPKGAMYMFPKIDTEMYGIKDDQKFVYDLLQQEK
VLLVQGSGFNWHKPDHFRVVTLPYVDQLEEAIGRLAKFLQSYRQD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttttgcaaaaaccgataaattagctcacgtccgctacgatattcgtgggcct
atacataaggaagcgacccgtctggaagaagaaggacataagattttaaaattaaacatt
ggtaacccagccccattcggttttgaagcccctgcggaaattttagttgatgttattcgt
aacttaccaaccgctcaaggctattgcgactctaagggtttgtactctgctcgtaaggcg
attgtgcaatattatcaattaaaaggtatgcgtgatttagatgtcggtgatgtttacatt
ggtaacggcgtatctgaactcatcacaatgtcaatgcaagccttgttaaatgatggcgat
gagattttaattccgatgccagattatccactttggacagcggcggcaacccttgcaggc
ggtaaagcggttcattacctttgcgatgaagaaaatgagtggtttccagatattgaagat
attaaatcgaaaatcaccccaagaaccaaagcaattttggtgattaacccgaataaccca
acgggagcagtgtatagccgtcagttattattggatattgtggcgattgcccgtgaacat
aacttgattattttctcagacgaaatttacgagaaaattgtctatgacggtgcggtacat
catcatcttgcccctcttgcccctgatcttttaacggtgacttataatggtttgtcaaag
gcataccgtgtggcaggtttccgtcaaggttggatggtgttaaacggcccgaaaaatcag
gcaaaaggctttattgaaggcttagatatgcttgcgtcaatgcgtttatgtgccaacacc
ccgatgcaacacgctattcaaacagcgttaggcggttatcaaagcattaacgaatttatc
ttaccaggtggtcgtttattggaacaacgtaataaggctcacgaattgctcaccaaaatc
ccagggattagctgtgtgaaaccaaaaggggcgatgtatatgttcccgaaaattgatacg
gaaatgtacggtatcaaagacgatcaaaaatttgtttacgatctgcttcaacaggaaaaa
gtgttgctggttcaaggctcaggctttaactggcataaaccagaccacttccgtgtggtg
acattgccgtatgttgatcagctggaagaagcgattggacgattagcgaagtttttgcag
agttatcgtcaggattaa

DBGET integrated database retrieval system