KEGG   Glaesserella parasuis ZJ0906: K756_01140Help
Entry
K756_01140        CDS       T02697                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pox_ser-thr_kin Med6
Motif
Other DBs
NCBI-GeneID: 16166565
NCBI-ProteinID: AGO15504
LinkDB All DBs
Position
complement(221006..222022)
Genome map
AA seq 338 aa AA seqDB search
MTMEKIYSPALVSFKKIREIGQEGRNSKVYLAHDEYMDAEIVVKEIANSKNEQTQRLLKE
AQILYASSHPNVVQIQYACKDDNNVYIAMPFYQNGSLKSLMATRMLTTREIIRYAIQFIS
GVAHIHSKCLVHLDIKPDNILLSDNNEALLSDFGLADYTDENGWYQVTCHYIKHTAPEIH
QQNGWATVQFDIFQIGLTLYRMCAGDKAFNAQFERVATSNDSFLSALTNKKFPTRSIILP
HIPEPLMKIVCQCLEVDVEKRYNNVRDILNDLSKIDYNGLDWQCTESDTSHEWNFTDEKG
LTYQVTRQKGEKAYTVVKNNRKTTPKSDTLRDYLLTLK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggaaaaaatttattcacctgcattagtttcgtttaaaaaaataagagaaatt
gggcaagaaggcagaaattctaaggtgtatttagcacacgatgaatatatggatgctgaa
attgtggtaaaagagattgcaaattcaaaaaatgagcaaacacaaagattactcaaagaa
gcacaaattctttatgcgagttcccaccccaatgttgtacaaatccaatatgcctgcaaa
gatgataataatgtgtatattgcaatgccattttaccagaacggatcattgaaatcgtta
atggctacacgtatgcttactacaagagaaattatccgatacgctattcaatttattagt
ggcgtagcccatattcactcaaaatgcttagttcatttagatattaaaccagataatatt
ttgctttctgataataacgaagctttactatcagactttggtttagcggattatacagat
gaaaatggatggtatcaggtaacttgccattacattaaacacacagcaccagaaattcat
caacagaatggctgggcaactgtgcaatttgatatttttcaaatcggattaactctatat
cgtatgtgtgctggagataaagcctttaacgctcaatttgagcgcgtagcgacatccaat
gatagtttcttatcggctctgaccaacaaaaaattcccgacaagaagcattattcttccg
catattcctgagccattgatgaaaattgtttgccaatgtttagaagtcgatgttgaaaaa
agatacaataatgtgagagatattcttaacgatttaagtaaaattgattacaatggctta
gattggcagtgtacagaaagtgacacttcgcacgaatggaactttactgacgaaaaaggt
ctaacttatcaagttactcgccaaaaaggcgaaaaggcatatactgtggttaagaataat
cgcaaaaccacaccaaaatctgacactctacgagattatttactgacactcaaatga

DBGET integrated database retrieval system