KEGG   Glaesserella parasuis ZJ0906: K756_07255Help
Entry
K756_07255        CDS       T02697                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00550  Peptidoglycan biosynthesis
hpaz01100  Metabolic pathways
hpaz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    K756_07255
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    K756_07255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hpaz01003]
    K756_07255
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpaz01011]
    K756_07255
Enzymes [BR:hpaz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     K756_07255
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     K756_07255
Glycosyltransferases [BR:hpaz01003]
 Polysaccharide
  Bacterial polysaccharide
   K756_07255
Peptidoglycan biosynthesis and degradation proteins [BR:hpaz01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   K756_07255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-GeneID: 16167052
NCBI-ProteinID: AGO16607
LinkDB All DBs
Position
1371778..1374333
Genome map
AA seq 851 aa AA seqDB search
MKIVKIIFSALLTLIIVGLVAVGFLYVHLKEDLPDVASLKTVELQQPMQIFTADGKLIGE
VGEQRRIPVKLADIPQTLIDAIIATEDTRFYEHKGIDPKGIMRAVWRSSQGDTQGASTIT
QQLARNFFLSPERKLERKLKEVILALEIEENLSKNEILELYLNKIYLGYRSYGVVAAAKT
YFGKKLEELTLSEMAIIAGLPKAPSTMNPLFSLKRAEARRNVVLGRMLEVGKITKAQYEQ
AKAEPIKAKYYGAALEFRADYVTEMIRQEMVKRYGEEVAYTKGFQVFATVLSADQKEAQD
ALRNNLIDYDRRHGWRGAEKLWNPKEKAWDEEKIIDHLSKLPSSEPFTSAAVLAISKDKA
NVMLPTGERVELKMSGMRWARKFINDSAQGKAPTQVKDVINVGEQIWVHQNSKGEWELGQ
IPDVNSALVSLNSDNGAIEAIVGGFSFEQSRFNRATQSLVQVGSSIKPFIYAAALNKGLS
LSTTLSDTPITITKAGQKPWIPKNSPNVYEGPLRLRVGLGKSKNVMMVRTVQMAGVEYVA
DYLQRFGFQKDQYQATEALALGAASFTPLEMARGYAVFDNGGYLIEPYIIGRILDSTGNE
LFKANPAIACLECDDKPVIYPEPTYFDFVKVKETTEETAIPKDDESDVIPELDIATKTKQ
NAPSLMADAIAVNREVHYAPRVISGEIAFLMRSALKTAITGEASQGWKGTSWRVANEIKR
SDIGGKTGTTNNAKIAWYAGFGSNLVTTVYVGFDDNKRELGRGEAGAQTALPAWIKYMKV
ALSDKEERKEQLPPNIIELQIEPTSGLLGGNMSEYFIKGTEPKKRYIVEKALEQPLGTNP
EGTEKISKELF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgtaaaaatcatatttagtgctttacttacactaataattgtgggtctagtt
gctgtaggttttctttatgttcatttaaaagaagatttacctgatgtagcaagcctaaaa
accgttgaacttcaacaacctatgcagatttttaccgctgacggtaaactcattggggaa
gtcggagagcaacgccgtattcctgtgaaacttgccgatattccgcaaaccttaattgat
gcgattattgcgacagaagatacccgtttttatgaacataaggggatcgatcctaaaggc
attatgcgtgccgtttggcgttcaagccaaggggatacgcaaggggcgagtaccattacg
caacagttagcgcgcaactttttcctttcgccagaacgcaaacttgagcgtaaattaaaa
gaagtgattttggcgttagaaattgaagaaaatctgtctaagaatgagattttagagtta
tatcttaataaaatttacttggggtatcgctcttatggggtggtggctgcggctaaaacc
tattttggtaaaaagctagaagaattaaccttatcggaaatggcgatcattgcagggcta
ccaaaagccccttccacgatgaaccctcttttctcgcttaaacgagcagaagcacgccgt
aatgtagtgcttgggcgtatgttagaagtcggaaaaatcaccaaagctcagtatgaacag
gctaaagcagaaccgattaaagccaaatattacggtgctgcgttagaatttcgcgccgac
tatgtgacagaaatgatccgtcaagaaatggtaaaacgttatggtgaagaagtcgcttac
accaaaggtttccaagtgtttgcaacagtgttatcagctgaccaaaaagaagcacaagat
gcactacgcaataacttgattgactacgaccgccgtcacggctggcgtggagctgagaaa
ctgtggaaccctaaagagaaagcgtgggacgaagaaaagatcatcgatcacctaagcaaa
ttgccaagctctgagccatttacgagtgcggcagtattggcaatttcaaaagataaagcg
aatgtgatgttgccaacaggggagcgtgttgagcttaaaatgtctggaatgcgttgggca
agaaaatttatcaatgactccgcccaaggtaaagcacctactcaagtaaaagacgtgatc
aatgttggtgaacaaatttgggtgcatcaaaatagtaagggtgaatgggaattagggcaa
attccagatgtaaactctgcactggtttcactaaatagtgataatggggcgatagaagcg
attgtgggcggtttcagttttgaacaaagccgttttaaccgtgcaacacaatctttagtg
caagtaggttcttcgattaaaccttttatctatgctgcagcattaaataaaggattgagc
ctttcaaccactctaagcgacacgcctattactattacaaaagcaggacaaaaaccgtgg
ataccgaaaaattcaccaaatgtgtatgaaggtccgttacgtttgcgagtaggcttgggt
aagtcgaaaaatgtgatgatggtgcgtacagttcagatggctggcgtagagtatgtagcg
gattacttacaacgctttggcttccaaaaagatcaatatcaagcgacagaagcattggca
ttaggggcagcgtccttcacgccgttagaaatggctaggggatatgctgtgtttgataat
ggtggctatttgattgaaccttatatcattggtcgtattttagatagtacaggcaatgaa
ctctttaaagcaaaccctgcaattgcctgtttagagtgtgatgataagccagtcatttat
ccagagccaacctattttgattttgtcaaagtaaaggaaactacagaagaaaccgcaatt
cctaaagatgatgaaagtgatgttattcctgaactggatattgccactaaaaccaaacaa
aatgccccaagcttgatggcagatgccatagctgttaatcgagaagtgcattatgcccca
agggttatcagtggggaaattgcattcttaatgcgaagtgcattgaaaacagctattaca
ggtgaagctagtcaaggttggaaaggaacaagctggcgtgtggcaaatgagatcaaacgc
agtgatattggtggaaaaacagggactacaaataacgccaagatcgcttggtacgcaggc
tttggctcaaacctcgtgacgacagtttatgttggttttgatgataataaacgtgaattg
ggacgtggtgaggctggcgctcaaacagcgttgccagcgtggattaagtatatgaaagtg
gctctttcggataaagaagagcgaaaagaacagttgccacctaatatcatagaattacaa
attgagcctacaagcggtctattagggggaaatatgagcgaatatttcattaaaggaact
gaacctaagaaacgttatattgtagagaaggcacttgaacaacctctaggtacaaatcct
gaaggaactgaaaaaatcagtaaagaattattctaa

DBGET integrated database retrieval system