KEGG   Glaesserella parasuis ZJ0906: K756_07260Help
Entry
K756_07260        CDS       T02697                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpaz01100  Metabolic pathways
hpaz01110  Biosynthesis of secondary metabolites
hpaz01130  Biosynthesis of antibiotics
hpaz01230  Biosynthesis of amino acids
Module
hpaz_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    K756_07260 (aroK)
Enzymes [BR:hpaz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     K756_07260 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin AAA_24 AAA dNK AAA_5 AAA_17 TsaE ABC_tran AAA_22 AAA_16 Mg_chelatase APS_kinase AAA_PrkA AAA_29 Ploopntkinase3 CoaE AAA_28 TraC_F_IV AAA_7 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 16165142
NCBI-ProteinID: AGO16608
LinkDB All DBs
Position
1374563..1375084
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLIGPMGAGKSTIGRQLAQMLNMDFLDSDAVIEERAGADIDWIFDIEGETGFR
KREERIINELTQSQGLVLSTGGGSVLSKDNRNVLSARGIVVYLETTVDKQFERTQRDKKR
PLLQTEDPYQTLVELAKIRNPLYEEIADIILQTDEQSAKVVATQIIDMIDNLQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacgtaatatctttctaattggccctatgggtgcaggtaaaagcacgatt
ggtcgtcaattagcacaaatgttaaatatggattttttagactcagacgctgtgattgaa
gagcgtgctggggcggatattgattggatcttcgatattgaaggcgaaacggggttccgt
aaacgtgaagagcgtatcattaatgagctgacacaatctcaaggtcttgtgctttcgacg
ggcggtggttcggtgttgtctaaagataaccgcaatgtgctttcagctcgtggtattgtg
gtttatcttgaaactacggtggataaacagtttgaacgtactcaacgtgataaaaaacgt
ccgttattgcaaacggaagatccatatcaaacgttagttgaattggcgaaaattcgtaat
ccgctttacgaagaaattgcggacattattttgcaaactgatgaacaaagtgcaaaagta
gtcgcaacgcaaatcattgatatgattgataatttacagtaa

DBGET integrated database retrieval system