KEGG   Helicobacter pylori B38: HELPY_0086Help
Entry
HELPY_0086        CDS       T00950                                 

Definition
(GenBank) Putative 5'-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00130  Ubiquinone and other terpenoid-quinone biosynthesis
hpb00270  Cysteine and methionine metabolism
hpb01100  Metabolic pathways
hpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HELPY_0086
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    HELPY_0086
Enzymes [BR:hpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     HELPY_0086
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     HELPY_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: CAX28641
UniProt: C7BXY8
LinkDB All DBs
Structure
PDB: 

Position
complement(89051..89746)
Genome map
AA seq 231 aa AA seqDB search
MVQKIGILGAMREEITPILELFGVGFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTL
TTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVANQLVQHDVDLSAFDHPLGFIPESAI
FIETSGSLNALAKKVANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASV
AFVCQKFGVPCCVLRSISDNADEEANMSFDEFLEKSAHTSAKFLKSMVDEL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaaaaattggcattttaggggcgatgagagaagaaataacccctatactagaa
ttgtttggcgtgggttttgaagagatccctttaggggggaatgttttccacaaaggcgtt
tatcataacaaggaaatcattgtcgcttatagcaagattggcaaggtgcattccacttta
accacaacgagcatgattttagcgtttggcgttcaaaaggtgctttttagcggggtggct
ggaagcttagttaaagatttaaaaatcaatgatttgttagtggccaatcaattagtccag
catgatgtggatttgagcgcgtttgatcaccctttagggttcatcccagaaagcgcgatt
tttattgaaacgagcggaagtttaaacgctttagctaaaaaagtcgctaatgagcaacat
atcgcgctcaaagaaggcgtcatcgcatcaggcgatcagtttgtgcacagcaaagaaagg
aaagagtttttagttagcgaatttaaggcgagtgcggtggaaatggagggggcgagcgtg
gcgtttgtgtgccaaaaatttggcgtgccatgctgcgtgttaaggagcattagcgataac
gctgatgaggaagctaacatgagctttgatgaatttttagaaaaaagcgctcacacttca
gcgaaatttttaaaaagcatggtggatgagctttag

DBGET integrated database retrieval system