KEGG   Helicobacter pylori B38: HELPY_0629Help
Entry
HELPY_0629        CDS       T00950                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase (D-alanylalanine synthetase) (D-Ala-D-Ala ligase)
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00473  D-Alanine metabolism
hpb00550  Peptidoglycan biosynthesis
hpb01100  Metabolic pathways
hpb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HELPY_0629 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HELPY_0629 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HELPY_0629 (ddlA)
Enzymes [BR:hpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HELPY_0629 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:hpb01011]
 Precursor biosynthesis
  Amino acid ligase
   HELPY_0629 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATPgrasp_TupA RimK VitD-bind_III ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: CAX29162
UniProt: C7BZC1
LinkDB All DBs
Structure
PDB: 

Position
complement(608934..609983)
Genome map
AA seq 349 aa AA seqDB search
MIVEFCVLFGGASFEHEISVVSAIALKGVLKDRIKYFIFLDENHHFYLIEESNMHSKYFA
QIKEKKLPPLILTHNGLLKNSFLGTKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIG
PRIEASVLSYNKYLTKLYAKDLGVKTLDYALLNEKNRANALDLIGFNFPFIVKPSNAGSS
LGVSVVKEEKELIYALDSAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYVEEPNKQ
EFLDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLYNDLFDGAIIRCDFFVIENEVYL
NEINPIPGSLANYLFDDFKTTLENLAQSLPKTPKIQIKNSYLLQIQKNK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgtggagttttgcgttttatttggtggggcgagttttgagcatgagatcagcgtt
gtgagcgcgatcgcgcttaaaggagtgttaaaggataggattaaatattttattttttta
gatgaaaaccaccatttttacttgattgaagaatccaacatgcattcaaaatacttcgct
caaatcaaagaaaaaaaattaccccccctaatcctcacgcacaatggcttgcttaaaaac
tcgtttttaggcactaagataatagaattgcctttagtgatcaatctcgtgcatgggggc
gatggcgaagacgggaaattagcgagcttgttagaattttatcgtatcgcttttataggc
cctagaattgaagcgagcgtgttgagttataacaaatatttaaccaagctttacgctaaa
gacttaggggtaaagactttggattatgcacttttgaatgaaaaaaaccgcgctaacgcc
ctggatttgattgggtttaatttccctttcattgtcaagcccagtaatgccggaagctcc
ttaggggtgagcgttgtgaaagaagaaaaagaattgatttacgctttagacagcgcgttt
gaatattctaaagaggtcttaatagagcctttcattcagggcgtgaaagaatacaatttg
gccggctgtaagatcaaaaaggatttttgtttttcctatgtggaagagcctaacaaacaa
gaatttttagatttcaaacaaaaatatttggatttttcacgcaataaagcccctaaagcg
aatctttctaacgccctagaagaacaattaaaagagaattttaaaaaactctataacgat
ttgtttgatggtgcgatcattcgttgcgatttttttgtcatagaaaatgaagtgtatctt
aatgagatcaaccccattcctggcagtttagccaactatttgttcgatgattttaaaaca
acgctagaaaatttagcgcaatcgttacccaaaacccctaaaatccaaatcaaaaactct
tatttgttgcagatccaaaagaataaataa

DBGET integrated database retrieval system