KEGG   Helicobacter pylori PeCan4: HPPC_07950Help
Entry
HPPC_07950        CDS       T01322                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00550  Peptidoglycan biosynthesis
hpc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPPC_07950
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HPPC_07950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpc01011]
    HPPC_07950
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hpc03036]
    HPPC_07950
Enzymes [BR:hpc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HPPC_07950
Peptidoglycan biosynthesis and degradation proteins [BR:hpc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   HPPC_07950
Chromosome and associated proteins [BR:hpc03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    HPPC_07950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ADO07788
UniProt: E1Q5G5
LinkDB All DBs
Position
complement(1601347..1603194)
Genome map
AA seq 615 aa AA seqDB search
MDNKNIDPNFNPERFLETQKYKGSVTALIFLLLFIVFLMVAFKKAFFAQANMPTLVMSKQ
DTATRGTIYSQDNYSLATSQTLFKLGFDTRFLNPDKEDFFIDFLSIYSNIPKKSLKDAIN
TKGYTILAYDLTPNTAANLRDLNKKFLTFGVFQNFKDSRDKVWQKQGLNIEVSGVSRHYP
YQNSLEPIIGYVQKQEEDKLTLTTGKKGVEKSQDHLLKAQQNGIRTGKRDVSFNFIQNHS
YTEVERLDGYEVYLSIPLKLQREIETLLDKAKDKLKAEEILVGIINPKSGEILSLASSKR
FNPNAIKTSDYESLNLSVAEKVFEPGSTIKPIVYSLLLDKNLINPKERIDLNHGYYQLGK
YTIKDDFIPSKKAVVEDILIQSSNVGMIKISKNLNPEDFYNGLLGYGFSQKTGIDLSLEA
TGKIPPLSAFKREVLKGSVSYGYGLNATFLQLLRAYAVFSNEGKLTTPYLVQRETAPNGD
IYIPNPKPTFQVINPKSARKMKETLIKVVRYGTGKNAQFEGLYIGGKTGTARVAKNGSYS
AQSYNSSFFGFAEDEKQVFTIGVVILGSHGKEEYYASKIAAPIFKEITEILVRYNYLSPS
IAIQNALEKNRFKIK
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggataataaaaacattgatcccaacttcaacccagagcgatttttggaaacccaaaaa
tacaagggctctgttacggctttaatctttttgttgctttttattgtttttttaatggtg
gcttttaaaaaagctttttttgcccaagccaacatgcccactctagtgatgagcaaacaa
gacactgcgactagggggactatctatagtcaagacaactacagcctggccacttcgcaa
acccttttcaaactgggctttgacacaaggtttttaaacccggataaagaagattttttc
attgatttcctttctatttatagcaatatccctaaaaaatccttaaaagacgctatcaat
acgaaaggctataccattctagcctatgatctcacgcccaataccgctgctaatcttagg
gacttgaataagaaatttttaacctttggggtttttcaaaatttcaaagactcgcgcgat
aaagtgtggcaaaagcaagggctaaacattgaagtgagtggcgtttctaggcattaccct
tatcaaaacagcctagagccaatcattggctatgtgcaaaaacaagaagaagacaaactc
actttaactaccggtaaaaaaggcgttgaaaaatctcaagatcacttgcttaaagcccaa
caaaatggcataagaacaggcaaaagagatgtgagttttaactttatccaaaaccactct
tatacagaggttgaacggcttgatggctatgaggtgtatttgagcattcctttaaaactc
caaagagaaattgaaaccctattagacaaagctaaagacaaactcaaggctgaagaaatc
ctagtgggtatcatcaaccccaaaagcggggaaattttatcgttagcttcaagcaagcgc
ttcaaccctaatgcgattaaaactagcgattatgaaagtttgaatttgagcgttgccgaa
aaggtttttgagccaggcagcacgattaaacccattgtttattccttgctgttagacaag
aatttaatcaaccccaaagaacgcattgatttaaaccatggctattaccaattaggaaaa
tacaccattaaagacgactttatccctagtaaaaaagccgttgttgaagacattttgatc
caatctagcaatgtgggcatgataaaaatcagcaaaaatctcaacccggaggatttctat
aatgggcttttaggctatggattttctcaaaaaacgggcattgatttatccttagaagcc
acaggaaagatccctcctttgtccgctttcaagcgtgaagtgttaaagggtagcgtctct
tatggctatgggctgaacgcaactttcttgcagcttttaagggcttatgcggtgttttcc
aatgaaggcaaattgactaccccctatttagtgcaacgagaaaccgcccctaatggcgat
atttacatccccaaccccaaacccacttttcaagtcatcaatccaaaaagcgctagaaaa
atgaaagaaaccttaattaaagtggtgcgttacggcacaggcaaaaacgctcaatttgaa
gggctatacatagggggcaaaacgggcacggctagggttgctaaaaacgggagttacagc
gcgcagtcctacaacagctctttttttgggttcgctgaagatgaaaagcaggtttttact
atcggcgtggttatcttaggctcgcacggcaaggaagaatattacgctagcaagattgca
gcccctatttttaaagaaatcaccgaaattttagtgcgttacaattacctatcgccctct
attgcgattcaaaatgcgttggagaaaaaccgctttaagataaaataa

DBGET integrated database retrieval system