Helicobacter pylori 51: KHP_0759 Help Entry KHP_0759          CDS       T02082                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpd  Helicobacter pylori 51 Pathway hpd01100   Metabolic pathways hpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KHP_0759 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KHP_0759 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACX97964 LinkDB All DBs Position 810996..811232 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDVAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttaaatgtggatgtggcg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system