KEGG   Helicobacter pylori 51: KHP_1101Help
Entry
KHP_1101          CDS       T02082                                 

Gene name
tufA
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hpd  Helicobacter pylori 51
Brite
KEGG Orthology (KO) [BR:hpd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hpd03012]
    KHP_1101 (tufA)
   03029 Mitochondrial biogenesis [BR:hpd03029]
    KHP_1101 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpd04147]
    KHP_1101 (tufA)
Translation factors [BR:hpd03012]
 Eukaryotic Type
  Elongation factors
   KHP_1101 (tufA)
 Prokaryotic Type
   KHP_1101 (tufA)
Mitochondrial biogenesis [BR:hpd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    KHP_1101 (tufA)
Exosome [BR:hpd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KHP_1101 (tufA)
  Exosomal proteins of breast cancer cells
   KHP_1101 (tufA)
  Exosomal proteins of colorectal cancer cells
   KHP_1101 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACX98294
UniProt: D0ITQ1
LinkDB All DBs
Position
complement(1225991..1227190)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIVAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRATQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaacagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagtgcagcgatttcagcggtgctttctttgaaaggt
cttgcagaaatgaaagactatgataatattgataacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagactgaaaacagacactatgcgcatgtg
gattgtccaggacacgctgactatgtaaaaaacatgatcaccggtgcggcgcaaatggac
ggagcgattttggttgtttctgcagctgatggtcctatgcctcaaaccagggagcatatc
ttattgtctcgtcaagtaggcgtgcctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagagcttgtagaaatggaagtgcgcgaattgttgagtgcg
tatgaattccctggcgatgacactcctatcgtagcgggttcagctttaagagctttagaa
gaagcaaaggctggcaatgtgggtgaatggggtgaaaaagtgcttaagctcatggctgaa
gtggatgcctatatccctactccagaaagagacaccgaaaaaactttcttgatgccggtt
gaagatgtgttctctattgcgggtagaggaactgtggttacaggtaggattgaaagaggt
gtggtgaaagtaggcgatgaagtggaaatcgttggtatcagagctacacaaaaaacgact
gtaaccggtgtggaaatgtttagaaaagagttagaaaaaggtgaagcgggcgataatgtg
ggcgtgcttttgagaggaactaaaaaagaagaagtagagcgcggtatggttctatgcaaa
ccaggttctatcactccgcacaagaaatttgagggagaaatttatgtcctttccaaagaa
gaaggcgggagacacactccattcttcaccaactaccgcccacaattctatgtgcgcacg
actgatgtgactggctctatcacccttcctgaaggcgtagaaatggttatgcctggcgat
aatgttaaaatcaccgtagagttgattagccctgttgcattggaattgggaactaaattt
gcgattcgtgaaggcggtaggaccgttggtgctggtgttgtgagcaatattattgaataa

DBGET integrated database retrieval system