KEGG   Helicobacter pylori 51: KHP_1259Help
Entry
KHP_1259          CDS       T02082                                 

Gene name
rhn
Definition
(GenBank) ribonuclease N
  KO
K07058  membrane protein
Organism
hpd  Helicobacter pylori 51
Brite
KEGG Orthology (KO) [BR:hpd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    KHP_1259 (rhn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB SLATT_5
Motif
Other DBs
NCBI-ProteinID: ACX98451
UniProt: D0IU58
LinkDB All DBs
Position
1370227..1371105
Genome map
AA seq 292 aa AA seqDB search
MRELFKSVRGFFRLLRMIFPKHFQNAFLGLSELFYYASSLSFYTILSLSPILLFVFSLFV
SSYMQAHSGEMEALIFPNAPKLIGAIKDFLENFKKTDIALGTLEEVSILVALVLFCENYR
SIASKIFQAKPRDYAHFKGKEIFLFWGFGTTLVFLFALPLVVFFDIKIQVFFEDKDSSLL
HVLRWIGTYAFFLILFTIPTNKVFKHYFWVFLWVFFTSVSWHVLKWAFTYYVLYNRTYHE
LYGSVSILWFLMSWVYVSWLVILIGMYGCKVCDTFDPKEVFKKFLGFFKKET
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagagaactttttaaaagcgttagagggttttttcgccttcttagaatgattttcccc
aagcactttcaaaacgcctttttgggcttgagcgaattgttttactacgcttctagcttg
agtttttatacgattttatctttatcgcctattttgttgtttgtgtttagtctttttgtg
tctagttacatgcaagcgcacagcggtgaaatggaagccttgattttccccaacgcccct
aaactcattggtgcgattaaggattttttagaaaattttaaaaaaacagacatagcctta
ggcacgcttgaagaagtgtctattttagtggcgttggtgcttttttgtgaaaattaccgc
tccattgcgtcaaaaatttttcaagcaaagcccagagattatgcgcattttaagggtaaa
gaaatctttttattttggggttttggcacgactttagtgtttttattcgctctgcctttg
gtggtgttttttgacattaagatccaagtgttttttgaagataaagattcaagtttgttg
catgttttaagatggataggcacttatgcgttttttttgatcctttttaccattcctaca
aataaggtgtttaaacattatttttgggtgtttttatgggtgttttttacgagcgtttct
tggcatgtgctgaaatgggctttcacttattatgtgttgtataaccgcacttaccatgag
ctttatgggagcgtttctattttgtggtttttgatgagctgggtgtatgtgagctggctt
gtgattttaattggcatgtatgggtgcaaggtgtgcgacacattcgatcctaaagaagtg
tttaagaaatttttgggcttttttaaaaaagaaacttga

DBGET integrated database retrieval system