KEGG   Helicobacter pylori ELS37: HPELS_06260Help
Entry
HPELS_06260       CDS       T01798                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hpe  Helicobacter pylori ELS37
Brite
KEGG Orthology (KO) [BR:hpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hpe03012]
    HPELS_06260
   03029 Mitochondrial biogenesis [BR:hpe03029]
    HPELS_06260
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpe04147]
    HPELS_06260
Translation factors [BR:hpe03012]
 Eukaryotic Type
  Elongation factors
   HPELS_06260
 Prokaryotic Type
   HPELS_06260
Mitochondrial biogenesis [BR:hpe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HPELS_06260
Exosome [BR:hpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HPELS_06260
  Exosomal proteins of breast cancer cells
   HPELS_06260
  Exosomal proteins of colorectal cancer cells
   HPELS_06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFF20772
UniProt: H8H6A5
LinkDB All DBs
Position
complement(1276480..1277679)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIVAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDSYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRATQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaatagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagcgcagcgatttcagcggtgctttctttgaaaggt
cttgcagaaatgaaagactatgacaatattgataacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagaccgaaaacagacactacgcgcatgtg
gattgcccaggacacgctgactatgtaaaaaacatgatcaccggtgcggcgcaaatggac
ggagcgattttggttgtttctgcagctgatggccctatgcctcaaactagagaacatatc
ttattgtctcgtcaagtaggcgtacctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagagcttgtagaaatggaagtacgcgaattgttgagcgca
tatgaattccctggcgatgacactcctatcgtagcgggttcagctttaagagctttagaa
gaagcaaaggctggcaatgtgggtgaatggggcgaaaaagtgcttaaactcatggctgaa
gtggattcctatatccctactccagaaagagacactgaaaaaactttcttgatgccggtt
gaagacgtgttttctattgcaggtagagggactgtggttacaggtaggattgaaagaggc
gtggtgaaagtgggcgatgaagtggaaatcgttggtatcagagctacacaaaaaacgact
gtaaccggtgtggaaatgtttagaaaagagttagaaaaaggtgaagccggcgataatgtg
ggcgtgcttttgagaggaactaaaaaagaagaagtagagcgcggtatggttctgtgtaag
ccaggttctatcactccgcacaagaaatttgagggagaaatttatgttctttctaaagaa
gaaggcgggagacacacaccattctttaccaactatcgcccgcagttctatgtgcgtacg
actgatgtgactggctctatcacccttcctgaaggcgtcgagatggttatgcctggcgat
aatgtgaaaatcaccgtggagttgattagccctgttgcgttagagttaggaaccaaattt
gcgattcgtgaaggcgggagaaccgttggcgctggtgttgtgagcaatattattgaataa

DBGET integrated database retrieval system