KEGG   Helicobacter pylori F30: HPF30_1170Help
Entry
HPF30_1170        CDS       T01895                                 

Definition
(GenBank) Type II restriction enzyme protein
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
hpf  Helicobacter pylori F30
Brite
Enzymes [BR:hpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     HPF30_1170
Prokaryotic defense system [BR:hpf02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    HPF30_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C Chordopox_A15
Motif
Other DBs
NCBI-ProteinID: BAJ57267
UniProt: E6NG84
LinkDB All DBs
Position
1241640..1242473
Genome map
AA seq 277 aa AA seqDB search
MKNHLSFDIFLQSLKTSNRALGFFTDWQKCLKNKNEISIALNHLNFLLGKDTKEFKSCVK
SFFEEYPKAFNVLNILIAVRDKDGVVLDADGNFYPLHSYFENDEKVYQFICQTGLEQIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKTMENHLSGLFTNAQLNFKEQVDIREFEDLYQ
AFGDDIKKFDFVVCGKDKTYFIEANFYTISGSKLNEVARSYQDLALKFEAFPNYEFIWIT
DGIGWWDAKSKLQEAYKSVEIYNLSNVNDFISKAQKW
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccatctgtcttttgatatttttttgcaaagtcttaagacaagcaatagggct
ttaggctttttcaccgattggcaaaagtgcctcaaaaataaaaatgaaataagcatcgct
ttaaaccatttgaattttttattggggaaagacacaaaagaatttaaaagttgcgttaag
agtttctttgaagaataccccaaagcttttaatgttttaaatattcttattgctgtgagg
gataaagatggggtagtgcttgatgctgatggcaatttttaccccctacattcttatttt
gaaaatgatgaaaaggtttatcaattcatctgtcaaacggggttggagcaaattttttgt
aacagaaatattaaagatttaaatgattttgtttttggtatagaagtggggcttgatagc
aatgcaagaaaaaatcgcagcggaaagactatggaaaatcatcttagcggtctttttacg
aacgctcaattaaattttaaagaacaagtagatattagagaatttgaggatttataccaa
gcttttggagatgatattaaaaaatttgattttgttgtttgtggtaaagataaaacttat
tttatagaagctaatttttataccattagcgggagtaagcttaatgaagtcgcaagatcc
tatcaagacttagctttaaaatttgaagcattccccaattacgaatttatttggataact
gatggcataggttggtgggacgctaaaagcaaactccaagaagcttacaaatctgtagaa
atctacaatttgagcaatgtaaatgattttatatcaaaggcgcaaaaatggtaa

DBGET integrated database retrieval system