KEGG   Helicobacter pylori G27: HPG27_1152Help
Entry
HPG27_1152        CDS       T00777                                 

Definition
(GenBank) translation elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
hpg  Helicobacter pylori G27
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hpg03012]
    HPG27_1152
   03029 Mitochondrial biogenesis [BR:hpg03029]
    HPG27_1152
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpg04147]
    HPG27_1152
Translation factors [BR:hpg03012]
 Eukaryotic Type
  Elongation factors
   HPG27_1152
 Prokaryotic Type
   HPG27_1152
Mitochondrial biogenesis [BR:hpg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HPG27_1152
Exosome [BR:hpg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HPG27_1152
  Exosomal proteins of breast cancer cells
   HPG27_1152
  Exosomal proteins of colorectal cancer cells
   HPG27_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACI27902
UniProt: B5Z8K3
LinkDB All DBs
Position
complement(1268804..1270003)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIIAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRATQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaatagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagtgcagcgatttcagcggtgctttctttgaaaggt
cttgcagaaatgaaagactatgataatattgataacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagactgaaaacagacactatgcgcatgtg
gattgcccaggacacgctgactatgtaaaaaacatgatcaccggtgcggcgcaaatggac
ggagcgattttggttgtttctgcagctgatggccctatgcctcaaaccagggagcatatc
ttattgtctcgtcaagtaggcgtgcctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagagcttgtagaaatggaagtgcgcgaattgttgagtgcg
tatgaattccctggtgatgacactcctatcatagcgggttcagctttaagagctttagaa
gaagcaaaggctggcaatgtgggtgaatggggtgaaaaagtgcttaaacttatggctgaa
gtggatgcctatatccctactccagaaagagacactgaaaaaactttcttgatgccagtt
gaagatgtgttctctattgcgggtagagggactgtggttacaggtaggattgaaagaggt
gtggtgaaagtaggcgatgaagtggaaatcgttggtatcagagctacacaaaaaacgact
gtaaccggtgtggaaatgtttagaaaagagttggaaaaaggtgaggccggcgataatgtg
ggcgtgcttttgagaggaactaaaaaagaagaagtagagcgcggtatggttctatgcaaa
ccaggttctatcactccgcacaagaaatttgagggagaaatttatgtcctttctaaagaa
gaaggcgggagacacactccattcttcaccaactaccgcccacagttctatgtgcgcacg
actgatgtgactggatctatcactcttcctgaaggcgtagaaatggttatgcctggcgat
aatgtgaaaatcactgtagagttgattagccctgttgcgttagagttgggaactaaattt
gcgattcgtgaaggcggtaggaccgttggtgctggtgttgtgagcaatattattgaataa

DBGET integrated database retrieval system