KEGG   Helicobacter pylori G27: HPG27_1321Help
Entry
HPG27_1321        CDS       T00777                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-(acylcarrierprotein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg00061  Fatty acid biosynthesis
hpg00780  Biotin metabolism
hpg01100  Metabolic pathways
hpg01212  Fatty acid metabolism
Module
hpg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HPG27_1321
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HPG27_1321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hpg01004]
    HPG27_1321
Enzymes [BR:hpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HPG27_1321
Lipid biosynthesis proteins [BR:hpg01004]
 Fatty acid synthase
  Component type
   HPG27_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ACI28069
UniProt: B5Z920
LinkDB All DBs
Structure
PDB: 

Position
complement(1427292..1427771)
Genome map
AA seq 159 aa AA seqDB search
MEQSHQNLQSQFFIEHILQILPHRYPMLLIDRVVELEANRKIVAYKNITFNEDVFNGHFP
NKPIFPGVLIVEGMAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLE
YHLEVLKHKGMIWQVGGTAQVDGKVVAEAELKAMIAERE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaagccatcaaaacttgcaatctcaattttttatagagcatatcttacagatt
ttacctcaccgctatcccatgctattgatagacagagtcgtggagttagaagccaataga
aaaattgtcgcttataagaatatcacttttaatgaagacgtgtttaatgggcatttccct
aataagcccattttcccgggcgttttgatcgtagagggcatggcgcaaacgggagggttt
ttagccttcactagcttgtgggggtttgaccctgaaatagccaaaacaaaaatcgtgtat
ttcatgacgattgataaggttaaattccgcattcctgtaaccccaggcgacagattggaa
taccatttagaagtcttaaagcataaaggcatgatctggcaagtgggcggcacggctcaa
gtggatggcaaagtggtcgctgaagccgaattaaaagccatgatcgcagagagagaataa

DBGET integrated database retrieval system