KEGG   Helicobacter pylori 908: hp908_0204Help
Entry
hp908_0204        CDS       T01893                                 

Definition
(GenBank) enoyl-acyl-carrier-protein NADH
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00061  Fatty acid biosynthesis
hpi00780  Biotin metabolism
hpi01100  Metabolic pathways
hpi01130  Biosynthesis of antibiotics
hpi01212  Fatty acid metabolism
Module
hpi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hpi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    hp908_0204
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    hp908_0204
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    hp908_0204
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hpi01004]
    hp908_0204
Enzymes [BR:hpi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     hp908_0204
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     hp908_0204
Lipid biosynthesis proteins [BR:hpi01004]
 Fatty acid synthase
  Component type
   hp908_0204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR DUF1509
Motif
Other DBs
NCBI-ProteinID: ADN79335
UniProt: E1S6V7
LinkDB All DBs
Structure
PDB: 

Position
193830..194663
Genome map
AA seq 277 aa AA seqDB search
MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYV
YELDVSKEEHFKSLYNNIKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISV
YSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGRHH
IRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSNGVS
GEVHFVDAGYHVMGMGAVEEKDNKATLLWDLQNNKGY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttaaaaggtaaaaaagggcttattgtgggggtggcaaacaataaatccatc
gcttatgggatcgctcaatcttgcttcaatcaaggggctactttggctttcacttatttg
aatgagagcttagaaaagcgcgtgaggcctatcgcgcaggaattgaatagcccctatgtg
tatgaattggatgtgagcaaagaagagcatttcaagtcgctatacaataatattaaaaag
gatttaggctcattggactttatcgttcatagcgtggcctttgcccctaaagaggcttta
gaggggagcttattagaaacttctaaaagtgcgtttaataccgctatggaaatttctgtt
tattctttaatagagctgacaaacaccctaaaacccttattgaataacggggcgtctgtt
ttgactttaagctatttgggcagcaccaaatacatggcgcattacaacgtgatggggttg
gctaaagcggccctagagagcgcggtgcgttatttagcggtggatttaggcaggcatcat
ataagggtgaatgccttatcggccgggcctatcagaacgctcgcttctagcgggatcgct
gattttaggatgattttaaaatggaatgaaatcaacgcccctttaagaaaaaatgtgagt
ttagaggaagtgggcaatgccgggatgtatttgctctctagcttgtctaatggggtgagt
ggggaagtgcattttgtggatgctggctatcatgtcatgggcatgggggctgtggaagaa
aaagataataaagctacgctattgtgggatttgcagaacaataaggggtattga

DBGET integrated database retrieval system