KEGG   Haemophilus pittmaniae: NCTC13334_00945Help
Entry
NCTC13334_00945   CDS       T06001                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hpit  Haemophilus pittmaniae
Pathway
hpit00061  Fatty acid biosynthesis
hpit00780  Biotin metabolism
hpit01100  Metabolic pathways
hpit01212  Fatty acid metabolism
Module
hpit_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hpit00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCTC13334_00945 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NCTC13334_00945 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hpit01004]
    NCTC13334_00945 (fabZ)
Enzymes [BR:hpit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NCTC13334_00945 (fabZ)
Lipid biosynthesis proteins [BR:hpit01004]
 Fatty acid synthase
  Component type
   NCTC13334_00945 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: SNV71747
LinkDB All DBs
Position
1:complement(936000..936449)
Genome map
AA seq 149 aa AA seqDB search
MSENQVSKVIEAKEIMQLLPHRYPFLLVDRVLDYKEGEWLKAIKNISVNEPCFTGHFPAE
PILPGVLILEALAQAMGLLAFKTHELKGGELFYFAGIDEARFKRPVLPGDQMELNVQVIK
ERRGITAFTGIATVNGEVACEAKLMCARR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaaaatcaagtaagcaaagtgattgaagcaaaggaaattatgcaattattaccg
catcgctatccattcttattggtcgatcgggtactggattacaaagaaggggaatggtta
aaagccattaaaaacattagcgttaatgaaccttgttttaccgggcatttccctgctgaa
cctattttgcctggagtcttgattttagaagctctggctcaagccatggggcttttggca
ttcaaaacccatgaattaaaaggtggtgagcttttctacttcgctggtattgatgaagcc
cgcttcaaacgtcccgtattaccgggagatcaaatggaactcaatgttcaagttatcaaa
gaacgtcgcggtattaccgcatttaccggcattgctacggtaaatggcgaagtagcctgc
gaagccaaattaatgtgtgcacgccgctaa

DBGET integrated database retrieval system