KEGG   Halanaerobium praevalens: Hprae_0077Help
Entry
Hprae_0077        CDS       T01941                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpk  Halanaerobium praevalens
Pathway
hpk00010  Glycolysis / Gluconeogenesis
hpk00020  Citrate cycle (TCA cycle)
hpk00620  Pyruvate metabolism
hpk00640  Propanoate metabolism
hpk00650  Butanoate metabolism
hpk00680  Methane metabolism
hpk01100  Metabolic pathways
hpk01110  Biosynthesis of secondary metabolites
hpk01120  Microbial metabolism in diverse environments
hpk01130  Biosynthesis of antibiotics
hpk01200  Carbon metabolism
Module
hpk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hprae_0077
   00020 Citrate cycle (TCA cycle)
    Hprae_0077
   00620 Pyruvate metabolism
    Hprae_0077
   00640 Propanoate metabolism
    Hprae_0077
   00650 Butanoate metabolism
    Hprae_0077
  09102 Energy metabolism
   00680 Methane metabolism
    Hprae_0077
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hprae_0077
Enzymes [BR:hpk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hprae_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II DXP_redisom_C TPP_enzyme_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADO76236
UniProt: E3DLX7
LinkDB All DBs
Position
93810..94991
Genome map
AA seq 393 aa AA seqDB search
MSIREKLSGNEAAAIALKQINPDVMAAFPITPSTEIPQYFSKYVANGSVDTEFVPVESEH
SAMSACVGSQAAGARTVTATSSCGLALMFEELYIASSSRLPIILSVVNRALSGPININAD
HSDSMGARDSGWIQLYSEDNQEAYDNLIQAVRIGEHEDVQLPVMVCQDGFITSHAIENIE
LLEKEVVQDFVGDYQAKEYLLNKDNPIAMGPYDTADYYMEHKYQQNRAMENAKAVIEKIA
AEFKEISGREYDFFETYKLEDADYAMVVLNSTAGTAKAAIDKMRAEGKKVGLLKIRVFRP
FNAEKLTELLKDIKYVAVMDRSETFSTAGGPVFHETSAALYPLAERPELISYIYGLGGRD
VTIESVESVFNDLMEIEKAGEVKNRYRYLGLRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcattagagaaaaattatcaggaaacgaagcagctgccatagctttaaaacagatt
aacccagatgtaatggctgcttttccaataacaccatcaacagaaataccacagtatttt
tctaaatatgtagcaaatggaagtgtagacacagaatttgtaccagtagaatcagaacat
agtgcaatgtcagcttgtgttgggtctcaagcagcaggagccagaacagttactgcaact
tcttcttgtggattagccttaatgtttgaagaactttatatagcttcttcatctagactg
ccaattattctttcagtagtaaatagagctttatcaggtccaattaatattaatgctgat
catagtgattcaatgggagctagagattctgggtggattcagctttattcagaggataat
caggaagcatatgataatttaattcaagcagttagaattggagaacatgaagatgttcaa
cttccagttatggtttgtcaagatggatttattactagtcacgctatagaaaatatagag
cttttggaaaaagaagtagtacaagattttgtgggagattatcaagctaaggaatatctt
ttaaataaagataatccaattgctatgggaccatatgatactgctgattactatatggag
cataaatatcaacaaaatagagctatggaaaatgcaaaagcagtaattgaaaaaattgca
gctgaatttaaagaaatctcaggtcgagaatatgatttttttgaaacatataaattagaa
gatgctgactatgcaatggttgttctaaactcaactgcaggtacagcaaaagcagcaatt
gataaaatgagagcagaaggtaaaaaggttggtctcttaaaaataagagttttccgtcct
tttaatgctgaaaaattaactgaacttttaaaagatattaagtatgtagcggtaatggat
agatcagaaaccttttctacagcaggtggaccagttttccacgaaacatctgcagcactt
tatcctttagcagaaagaccagaattaattagttatatttatggcttaggtggccgtgat
gtaacaattgaatcagtagaaagtgtttttaatgatttaatggaaattgaaaaagccgga
gaagttaaaaatagatatagatatttaggattaagagaataa

DBGET integrated database retrieval system