KEGG   Halanaerobium praevalens: Hprae_0982Help
Entry
Hprae_0982        CDS       T01941                                 

Definition
(GenBank) glutaredoxin 3
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hpk  Halanaerobium praevalens
Brite
KEGG Orthology (KO) [BR:hpk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hprae_0982
Enzymes [BR:hpk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Hprae_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin Pyr_redox GIDA HI0933_like NAD_binding_8 Thi4 GST_N_3 FAD_binding_2 DUF836 DAO FAD_oxidored SH3BGR FAD_binding_3 K_oxygenase NAD_binding_9 Thioredoxin_3 NAD_binding_7 AlaDh_PNT_C Thioredoxin_9 Thioredoxin_2 GST_N_2
Motif
Other DBs
NCBI-ProteinID: ADO77136
UniProt: E3DS12
LinkDB All DBs
Position
1086348..1087535
Genome map
AA seq 395 aa AA seqDB search
MSKVLKIEVYSKDWCPYCKKAKAFLKSKNLDFQEIDIKKENNYEVMKKRTNNKTVPQIII
NNQSLGGYDDLIELEKTGELNKILGVKTKDLSQTEWELIILGAGPAALNAALYAARKGIK
LLVLTQDIGGQVITTNEIDNYLGKAGTNGADLIADFWDHLAKYEVKTVIGEEVIAIKEKA
NKKIIETNNKKKYSSQAVIIATGAKKRHLGLKQEYVLTGKGVHYCASCDAFLYKEQPVAV
VGGGNSGLEAALDLANIGSEVDLIELESKLMGDQYLQNKVKANKNIRVHTETTVDQIIGE
EKLESIIIKNAKDQSTKELNVNALFIEIGLIANSSFAKNLVETNKQQEIIIDQQNQTAAK
GIWAAGDVTNIIDKQIIISAAEGAKAALRVNQYLA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagtattaaaaattgaagtttattctaaagattggtgtccttattgtaaaaag
gctaaagcttttttgaaaagtaaaaatttagattttcaagaaattgatattaaaaaagaa
aataattatgaggtgatgaaaaaaagaacaaataataaaactgttcctcaaattattatt
aataaccaaagtttaggtggttatgatgacttaatcgaattagaaaaaacgggggaatta
aataaaattttgggagtgaaaacaaaagatttatcgcaaacagaatgggaattaatcatt
ttaggagctgggccagcagctttaaatgcagctctatatgctgctcgcaaaggaattaaa
cttttagttttaactcaagatataggtggtcaggtgattacaactaatgagattgataat
tatttaggtaaagcaggaactaatggagctgatttaattgctgatttttgggatcatctt
gctaaatatgaagttaaaacagtaattggagaagaagtaatagcaattaaagaaaaagca
aataaaaaaataattgaaactaataataagaaaaaatattcaagtcaagcagtaattatt
gcaactggagctaaaaaaagacatttaggtttaaaacaagaatatgttttaactggtaaa
ggagttcattattgtgctagttgtgatgcttttttatataaagaacaaccagtagctgta
gttggtgggggtaactctggtttagaagcagcacttgatttagccaatattggctcagaa
gttgatttaattgagttagagtctaaattaatgggagatcaatatttacaaaataaggtt
aaagcaaataaaaatataagagtacacactgaaactactgtagatcaaataattggggaa
gaaaaattagaatcgattattataaaaaacgctaaagatcaaagtactaaagaattaaat
gtgaatgctttatttattgaaattggtttgattgctaatagtagttttgctaaaaactta
gttgaaactaataagcagcaagaaattattattgatcagcaaaatcaaacagctgctaaa
ggaatttgggctgcaggggatgtaactaatattattgataaacaaataattatttcagca
gctgaaggagctaaggcagctcttagagttaatcaatatttagcttaa

DBGET integrated database retrieval system