KEGG   Halanaerobium praevalens: Hprae_1589Help
Entry
Hprae_1589        CDS       T01941                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hpk  Halanaerobium praevalens
Pathway
hpk00970  Aminoacyl-tRNA biosynthesis
hpk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hprae_1589
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hpk03029]
    Hprae_1589
Enzymes [BR:hpk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Hprae_1589
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Hprae_1589
Mitochondrial biogenesis [BR:hpk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Hprae_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY DUF3666
Motif
Other DBs
NCBI-ProteinID: ADO77716
UniProt: E3DPF4
LinkDB All DBs
Position
complement(1756655..1758100)
Genome map
AA seq 481 aa AA seqDB search
MSTKYETVIGLEVHVQLDTKSKIFCGCSTEFGKDPNENTCPVCLGLPGTLPVLNKKVVDY
AIMAGLALNCDIAEYSKFDRKNYFYPDLPKAYQISQFDLPVAEAGEIEIETENGIFQIGV
TRVHLEEDAGKLIHEGSIDKSKGSLIDYNRTGVPLIEIVSEPDMRTPAQAKAYLTELKMI
MEYLDISDCNMEEGSLRCDANISLRPVGQKEFGTKAELKNMNSFSAVEKGLEYEIKRQHE
ILEAGEKVVQETRTWDESLNKTISMRGKEEAHDYRYFPEPDLVPLEINEAWKEEMRKKIP
ELPREKYKRFISELGLPKYDAGVLTGEKEMAVFFEEVLKDYDDPKNLSNWMMGEFLKLLN
ENNHSPFESGVSPINLAKMLKLIDQEVISGKIAKEVFEKMYNNGSDPEKIVEAEGLKQIS
DEDELENIVSGIIAENPEAVEDVKNGKDRAIGFLVGQVMKETRGKANPGLVNQMLRDKLM
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtccactaaatatgaaacagtaattggacttgaagtccatgtacaattagatacaaag
tctaaaatattctgtggttgtagtacagaatttggaaaagatccaaatgaaaatacatgt
ccagtttgccttggtttgccaggtactttgccagttttaaataaaaaagtagttgattat
gctattatggcaggtttagctttaaattgtgatattgctgaatactctaaatttgaccgt
aaaaattatttttatcctgatttacctaaagcttatcaaatttcacaatttgatttacca
gtggctgaagctggagagattgaaattgaaactgaaaatggaatttttcagattggagtc
actagagtccatctagaagaagatgctggtaaattgattcatgaaggtagtattgataaa
tctaaaggtagtttaatagattataacaggacaggtgtacctttgattgaaattgttagt
gagccagatatgagaacacctgctcaagctaaagcttatttaactgaattaaaaatgatt
atggaatatcttgatatttcagattgcaatatggaagaaggatcattacgttgtgatgca
aatatttctttaaggcccgttggtcaaaaagaatttgggactaaagctgagctaaaaaat
atgaactcctttagtgctgttgaaaaaggtttagaatatgaaattaaaagacagcatgag
attttagaagcaggtgaaaaagtagttcaagaaacaagaacttgggatgaatctttaaac
aaaacaatttcaatgcggggtaaagaagaagctcatgattatcgttatttccctgaaccc
gatttagtgcctttagaaattaatgaagcctggaaagaagaaatgcgcaaaaagattcct
gagttgccaagagaaaaatataagcgttttatttcagaattgggtttacctaaatatgat
gcaggagttttaacaggtgagaaagagatggcagttttctttgaagaagtacttaaggat
tatgatgatcccaaaaatttaagtaattggatgatgggagaatttttaaaattattaaat
gaaaataatcatagtccttttgagtcaggagttagtccaattaatttagctaaaatgcta
aagctaattgatcaagaagttataagtggtaaaattgcaaaagaagtttttgagaaaatg
tataataatggttcggatccagaaaaaattgtagaagctgaaggtttaaagcaaattagt
gatgaagatgaattagaaaatatagttagtggaattattgctgaaaatccagaggcagtt
gaagatgttaaaaatggtaaagatagggcaattggatttttagttggtcaggtaatgaaa
gaaactagaggaaaagctaatcctggtttagttaatcaaatgctaagagataaattaatg
aactaa

DBGET integrated database retrieval system