KEGG   Halanaerobium praevalens: Hprae_1838Help
Entry
Hprae_1838        CDS       T01941                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hpk  Halanaerobium praevalens
Brite
KEGG Orthology (KO) [BR:hpk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hprae_1838
Enzymes [BR:hpk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Hprae_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 Thi4 HI0933_like DAO FAD_binding_3 NAD_binding_7 AlaDh_PNT_C Tex_YqgF NAD_binding_8 Shikimate_DH Rad1 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ADO77963
UniProt: E3DQQ2
LinkDB All DBs
Position
complement(2010156..2011682)
Genome map
AA seq 508 aa AA seqDB search
MLEADIKEQLKEYFQLLEANVLIKASIGSDQKSKEMHSFLKELASLSSKLELKETSLART
PSFSLTAAGQETGVSFAGIPLGHELNSLVLALLQASGREPKVEAKLIKQIKNIEQEYNFE
TYISLSCNNCPDVVQALNIMSIINPNITHTMIDGAFFKGEVEEKSILAVPAIYLNGEFFK
SGRLTLTKILEHLVGKIDNSELNEKDPYDVLIVGGGPAAASAAIYAARKGIKTAIVAERF
GGQVLDTAEIENFIGQKNIEGSKLISKFKEHIEDYDIDLILSQKAKSLEKNELVELELES
GAVLKSKTLIAATGASWRQLNIPGEAEFKNKGVAYCPHCDGPMFEDKDVAVIGGGNSGVE
AAIDLAGIAKSVTLLEFLPELKADQVLQNRLEEIDNLKVIKNVDCQEIKGTDTVNAISYV
ERDSGQKQELDLDGVFVQIGLKANTDWLKDKVELNQYGEIITTANQSTNLAGVFAAGDCA
DSIYKQIVISIGSGASAALAAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgttagaggcagatatcaaagagcaattaaaagaatattttcagttattagaagccaat
gttttaattaaagccagcattggttctgatcaaaaatctaaagaaatgcattcattttta
aaagaattagcctctctttcttctaaacttgaactaaaagaaacttcgctggccagaaca
cctagttttagcttaactgcagcaggtcaagagactggtgttagttttgctggtatacct
ttaggtcatgaattaaattcactagttttagctttactgcaggctagtggtcgagaacct
aaggtagaagcaaaattaattaagcagataaaaaatattgagcaagaatataattttgaa
acttatattagcttaagttgtaataattgtcctgatgttgtacaagctttaaatattatg
agtataattaaccccaatattactcatacaatgattgatggtgctttctttaaaggtgag
gttgaagaaaaaagcatcttagctgtaccagcaatttatttaaatggagaattctttaag
agtggtcgtttaactttaactaagatcttggaacatttagttggtaaaatagataattct
gaattaaatgagaaagatccttatgatgtcttaattgtcggtggaggtccagcagcagcc
agtgctgctatttatgcagcgcgaaaagggattaaaactgcaattgtagctgaacgtttt
ggcggccaagttttagatactgctgaaattgagaactttattggtcaaaaaaatatagag
ggttctaaattaatcagtaaatttaaagaacatattgaagactatgatattgacttaatt
ttatctcaaaaagctaagagtttagaaaaaaatgaattagtagaattagagctagaaagt
ggagcagttttaaagtctaaaactttaattgctgctactggagcaagctggcgccaactt
aatattcctggtgaagctgagtttaagaataaaggagttgcttattgtcctcactgtgat
ggcccaatgtttgaagataaagatgtggctgttatcggaggtggtaattctggagtcgaa
gcagcaattgatttggctgggattgctaagagtgtaaccttattagaatttctaccagaa
ttaaaagctgatcaggttctccaaaatcgattagaagagattgataatcttaaggtaatt
aaaaatgtagattgtcaggaaattaagggaacagatacagtaaatgctattagttatgtt
gaaagagatagtggtcaaaaacaagaacttgatttagatggagtttttgtgcaaattggt
ttaaaagcaaatacagattggctaaaagataaagttgagctgaatcaatatggtgaaatt
ataaccactgccaatcagagtaccaatttagctggagtttttgcagctggtgattgtgca
gatagcatttataaacaaattgttatttcaattggttctggagctagtgcagctttagca
gcttttgattatttaattagaaattaa

DBGET integrated database retrieval system