KEGG   Helicobacter pylori B8: HPB8_341Help
Entry
HPB8_341          CDS       T01262                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00330  Arginine and proline metabolism
hpl01100  Metabolic pathways
hpl01110  Biosynthesis of secondary metabolites
hpl01130  Biosynthesis of antibiotics
hpl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    HPB8_341 (proC)
Enzymes [BR:hpl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     HPB8_341 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-ProteinID: CBI65898
UniProt: D7FCJ1
LinkDB All DBs
Position
complement(306866..307639)
Genome map
AA seq 257 aa AA seqDB search
MEILQFIGYGNMAQAILEGAHEILSKRFILEITGRNPEKIAPFLQEKNIQAQIVPYKDAI
DIHQKFVFLLFKPYNLKDFNYQGQAKSVLSALAGVGFKALSDAINSLHYLKCMPNIASKF
ALSSTAVCEKSPMPLISQKALSIIESFGNCVRVGNEEQVDSSVATNGSALAFLSLVASSL
KDAGIREGLNARDSLELVKMSFKGFAKLLEKERPEMIIEQICTPKGATIEGLSVLEKKGV
RGAFIEACQKSVKKMRL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcttacaattcatcggctatgggaatatggctcaagcgattttagaaggcgct
catgaaattttatccaagcgttttattttagagatcaccgggcgaaaccctgaaaaaatc
gccccttttttacaagaaaaaaacattcaagctcaaatagtgccttacaaagacgctatt
gatatacaccaaaaattcgtgtttttactttttaagccttacaaccttaaggattttaat
tatcaagggcaagctaaaagcgttttgagcgctttagctggcgtgggttttaaagcttta
agcgatgcgataaattctttacattacttaaaatgcatgcccaatattgcgagtaagttc
gccctttcttctacggcggtgtgtgaaaaatcgcccatgcccttaataagccaaaaggct
ttgagcattattgagagttttgggaattgcgtgcgagtgggcaatgaagagcaggttgat
tctagtgtagcgacaaacgggagcgcgctcgcgtttttaagcttggtagcgagcagtttg
aaagatgccggtattagggagggcttgaacgctagagattctttagaattggtgaagatg
agttttaaaggctttgccaagctgttagaaaaagaacgccctgagatgattatagagcaa
atttgcacccctaaaggcgcaacgattgaaggcttgagcgttttagaaaaaaagggggtt
aggggagcgtttatagaagcttgccaaaagagcgtgaaaaaaatgcgcctctaa

DBGET integrated database retrieval system