KEGG   Helicobacter pylori SJM180: HPSJM_03740Help
Entry
HPSJM_03740       CDS       T01323                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hpm  Helicobacter pylori SJM180
Pathway
hpm00473  D-Alanine metabolism
hpm00550  Peptidoglycan biosynthesis
hpm01100  Metabolic pathways
hpm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPSJM_03740 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPSJM_03740 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HPSJM_03740 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpm01011]
    HPSJM_03740 (ddl)
Enzymes [BR:hpm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPSJM_03740 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hpm01011]
 Precursor biosynthesis
  Amino acid ligase
   HPSJM_03740 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_TupA GARS_A VitD-bind_III ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADO02338
UniProt: E1PZJ7
LinkDB All DBs
Structure
PDB: 

Position
762214..763257
Genome map
AA seq 347 aa AA seqDB search
MEFCVLFGGASFEHEISIVSAIVLKGVLKDRIKYFIFLDENHHFYLIEESNMHSKYFAQI
KEKKLPPLMLTHNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
IEASVLSYNKYLTKLYAKDLGVKTLDYILLNEKNRANALDLIGFNFPFIVKPSNAGSSLG
VNVVKEEKELNYALDSAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYIEEPNKQEF
LDFKQKYLDFSRTKAPKANLSNALEKQLKENFKKLYNDLFDGAIIRCDFFVIENEVYLNE
INPIPGSLANYLFDDFKTTLENLAQSLPKTPKIQIKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggagttttgcgttttatttggtggggcgagttttgagcatgaaatcagcattgtgagc
gcgatcgtgcttaaaggggtgttaaaggataggattaaatactttatttttttagatgaa
aaccatcatttttacttgattgaagaatcgaacatgcattcaaaatacttcgctcaaatc
aaagaaaaaaaattaccccccctaatgctcacgcacaatggtttgcttaaaaactcgttt
ttaggcgctaagataatagaattgcctttagtgatcaatcttgtgcatgggggcgatggc
gaagacgggaaattagcgagcttgttagaattttatcgtatcgcttttataggccctagg
attgaagcgagcgtgctgagttacaacaaatatttaaccaaactttacgctaaagattta
ggggtaaagactttggattatattcttttgaatgaaaaaaaccgcgctaacgccttagat
ttgattgggtttaatttccctttcattgtgaaacccagtaacgctgggagctctttaggg
gtgaatgttgtgaaagaagaaaaagaattaaattacgctttagacagcgcgtttgaatat
tctaaagaagttttaatagagcctttcattcagggcgtgaaagaatacaatttggccggt
tgcaagatcaaaaaggatttttgtttttcctatattgaagagcccaacaaacaggaattt
ttagatttcaaacaaaaatatttggatttttcacgcaccaaagcccctaaagcgaacctt
tctaacgccctagaaaaacaactaaaagagaattttaaaaaactctataacgacttgttt
gatggcgcgatcattcgttgcgatttttttgtcatagaaaatgaagtgtatcttaatgag
atcaaccccattcctggcagtttagccaattatttgtttgatgattttaaaacaacgcta
gaaaatttagcacaatcgttacccaaaacccctaaaatccaaatcaaaaactcttatttg
ttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system