KEGG   Helicobacter pylori India7: HPIN_05760Help
Entry
HPIN_05760        CDS       T01918                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
hpn  Helicobacter pylori India7
Pathway
hpn00330  Arginine and proline metabolism
hpn01100  Metabolic pathways
hpn01110  Biosynthesis of secondary metabolites
hpn01130  Biosynthesis of antibiotics
hpn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    HPIN_05760
Enzymes [BR:hpn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     HPIN_05760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ADU80348
UniProt: E8QH86
LinkDB All DBs
Position
1174211..1175005
Genome map
AA seq 264 aa AA seqDB search
MEILQFIGYGNMAQAILEGAHETLSKRFILEITGRNPEKIAPFLQEKNIQAQIVPYKDAI
DIHQKFVFLLFKPYNLKDFNYQGQAKSVLSALAGVGFEALSDAIDSLHYLKCMPNIASKF
ALSSTAVCEKSPMPLISQKALSVIESFGNCVRVGNEEQVDASIATNGSALAFLSLVASSL
KDAGIREGLNARDSLELVKMSFKGFAKLLEKERPEMIIEQICTPKGATIEGLSVLEKKGV
RGAFIKACQKSVKKCASKNYTLKK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcttacaattcatcggctatgggaatatggcccaagcgattttagaaggcgct
catgaaactttatccaagcgttttattttagagattaccgggcgaaaccctgaaaaaatc
gccccctttttacaagaaaaaaacattcaagctcaaatcgtgccttacaaagacgctatt
gatatacaccaaaaattcgtgtttttactttttaagccttacaaccttaaggactttaat
tatcaagggcaagctaaaagcgttttgagcgcactagctggcgtgggttttgaagcttta
agcgatgcgatagattctttacattacttaaaatgcatgcccaatattgcgagcaagttc
gccctttcttctacggcggtgtgcgaaaaatcgcccatgcccttaataagccaaaaggct
ttgagtgttattgagagttttgggaattgcgtgcgagtgggcaatgaagagcaggtggat
gccagcatagcgacaaacgggagcgcgctcgcgtttttaagcttggtagcgagcagtttg
aaagatgccggtattagggagggcttgaacgctagagattctttagaattggtgaagatg
agtttcaaaggctttgccaagctgttagaaaaagaacgccccgagatgattatagagcaa
atttgcacccctaaaggcgcaacgattgaaggcttgagcgttttagaaaaaaagggggtt
aggggagcgtttatcaaagcatgccaaaagagcgtgaaaaaatgcgcctctaaaaattac
actcttaaaaaataa

DBGET integrated database retrieval system