KEGG   Helicobacter pylori India7: HPIN_06355Help
Entry
HPIN_06355        CDS       T01918                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hpn  Helicobacter pylori India7
Brite
KEGG Orthology (KO) [BR:hpn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hpn03012]
    HPIN_06355
   03029 Mitochondrial biogenesis [BR:hpn03029]
    HPIN_06355
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpn04147]
    HPIN_06355
Translation factors [BR:hpn03012]
 Eukaryotic Type
  Elongation factors
   HPIN_06355
 Prokaryotic Type
   HPIN_06355
Mitochondrial biogenesis [BR:hpn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HPIN_06355
Exosome [BR:hpn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HPIN_06355
  Exosomal proteins of breast cancer cells
   HPIN_06355
  Exosomal proteins of colorectal cancer cells
   HPIN_06355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADU80464
UniProt: E8QHK2
LinkDB All DBs
Position
complement(1288242..1289441)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIIAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRATQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaatagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagtgcagcgatttcagcggtgctttctttgaaaggt
cttgcagaaatgaaagactatgataatattgacaacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagactgaaaacagacactatgcgcatgtg
gattgcccaggacacgctgactatgtaaaaaacatgatcaccggtgctgcacaaatggac
ggagcgattttggttgtttctgcagctgatggccctatgcctcaaaccagagaacatatc
ttattgtctcgtcaagtaggcgtgcctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagagttggtagaaatggaagtgcgcgaattgttgagtgcg
tatgaattccctggtgatgacactcctattatagcgggttcagctttaagagctttagaa
gaagcaaaggctggcaatgtgggtgaatggggtgaaaaagtgcttaagctcatggctgaa
gtggatgcctatatccctactccagaaagagacactgaaaaaactttcttgatgccggtt
gaagatgtgttctctattgcgggtagagggactgtggttacaggcaggattgaaagaggt
gtggtgaaagtaggcgatgaagtggaaatcgttggtattagagctacacaaaaaacgact
gtaaccggtgtggaaatgtttagaaaagagttagaaaaaggtgaggccggcgataatgtg
ggcgtgcttttgagaggaactaaaaaagaagaagtagagcgtggtatggttctatgcaaa
ccaggttctatcactccgcacaagaaatttgagggagaaatttatgtcctttctaaagaa
gaaggcgggagacacactccattcttcaccaactaccgcccgcaattctatgtgcgcacg
actgatgtgactggctctatcacccttcctgaaggcgtagaaatggttatgcctggcgat
aatgttaaaatcactgtagagttgattagccctgttgcgttagagttgggaactaaattt
gcgattcgtgaaggcggtaggaccgttggtgctggtgttgtgagcaatattatcgaataa

DBGET integrated database retrieval system