KEGG   Helicobacter pylori 35A: HMPREF4655_20365Help
Entry
HMPREF4655_20365  CDS       T01892                                 

Gene name
mtnN
Definition
(GenBank) MTA/SAH nucleosidase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00130  Ubiquinone and other terpenoid-quinone biosynthesis
hpo00270  Cysteine and methionine metabolism
hpo01100  Metabolic pathways
hpo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HMPREF4655_20365 (mtnN)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    HMPREF4655_20365 (mtnN)
Enzymes [BR:hpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     HMPREF4655_20365 (mtnN)
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     HMPREF4655_20365 (mtnN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: ADU40510
UniProt: E6S4M8
LinkDB All DBs
Structure
PDB: 

Position
358456..359169
Genome map
AA seq 237 aa AA seqDB search
MCDWEKMVQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHDKEIIVAYSKIG
KVHSTLTTTSMILAFGVQKVLFSGVAGSLNKDLKINDLLVAIQLVQHDVDLSAFNHPLGF
IPESAIFIETSESLNALAKKVANEQHITLKEGVIASGDQFVHSKERKEFLVSEFKASAVE
MEGASVAFVCQKFGVPCCVLRSISDNADEKANMSFDAFLEKSAQTSAKFLKSMVDKL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgattgggagaaaatggtgcaaaaaattggcattttaggagcgatgagagaagaa
ataacccctattttagaattgtttggcgtggattttgaagagatccctttaggggggaat
gttttccataaaggcgtttatcatgataaggaaatcattgtcgcttatagcaagattggc
aaggtgcattccactttaaccacaacaagcatgattttagcgtttggcgttcaaaaggtg
ctttttagcggggtggctggaagcttaaataaagacttaaaaatcaatgatttgttagtg
gctattcaattagtccagcatgatgtggatttgagcgcgtttaaccaccctttagggttc
atcccagaaagcgcgatttttattgaaacgagcgaaagtttaaacgctttggctaaaaaa
gtcgctaatgagcaacacatcacgctcaaagaaggcgtcatcgcatcaggcgatcagttt
gtgcatagcaaagaaaggaaagagtttttagttagcgagttcaaggcgagcgcggtggaa
atggagggggcgagcgtggcgtttgtgtgccaaaaatttggcgtgccatgctgtgtgcta
aggagcattagcgataacgctgacgagaaagctaacatgagctttgatgcgtttttagaa
aaaagcgctcaaacttcagcgaaattcttaaaaagcatggtggataagctttag

DBGET integrated database retrieval system