KEGG   Helicobacter pylori 35A: HMPREF4655_20937Help
Entry
HMPREF4655_20937  CDS       T01892                                 

Gene name
aroC
Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpo01100  Metabolic pathways
hpo01110  Biosynthesis of secondary metabolites
hpo01130  Biosynthesis of antibiotics
hpo01230  Biosynthesis of amino acids
Module
hpo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hpo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF4655_20937 (aroC)
Enzymes [BR:hpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     HMPREF4655_20937 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: ADU41038
UniProt: E6S1Y6
LinkDB All DBs
Structure
PDB: 

Position
complement(910879..911976)
Genome map
AA seq 365 aa AA seqDB search
MNTLGRFLRLTTFGESHGDVIGGVLDGMPSGIKIDYALLENEMKRRQGGRNVFITPRKED
DKVEITSGVFEDFSTGTPIGFLIHNQRARSKDYDNIKNLFRPSHADFTYFHKYGIRDFRG
GGRSSARESAIRVAAGAFAKMLLREIGIVCESGIMEIGGIKAKNYDFNHALKSEIFALDE
EQEEAQKTAIQNAIKNHDSIGGVALIRARSAKTNQKLPIGLGQGLYAKLDAKIAEAMMGL
NGVKAVEIGKGVESSLLKGSEYNDLMDQKGFLSNRSGGVLGGMSNGEEIIIKVHFKPTPS
IFQSQQTIDINNNECECLLKGRHDPCIAIRGSVVCESLLSLVLADMVLLNLTSKIEYLKT
IYNEN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacactttggggcgttttttaaggcttacgacttttggggaatcgcatggggatgtg
atagggggggtattagacggcatgcctagcgggattaaaatagactatgcgttattagaa
aatgaaatgaagcgccgccaaggggggaggaatgtttttattacgccacgaaaagaagac
gataaagtggaaataacaagcggggtttttgaagattttagcacagggactcccataggg
tttttaatccacaaccaaagggctaggagcaaggattatgataacattaaaaaccttttt
aggcctagccatgcggatttcacttattttcataaatacggcatcagagattttaggggt
ggggggaggagttcggccagagagagcgctataagagtggctgctggggcgtttgctaaa
atgcttttaagagaaattggtattgtttgtgaaagcggaatcatggaaatagggggcatt
aaagccaaaaattatgatttcaatcacgctttaaaaagcgagatttttgccctagatgaa
gagcaagaagaagcgcaaaaaacagccattcaaaacgctatcaaaaaccacgatagtata
gggggcgtggctttgattagagcaaggagtgcaaaaacaaatcaaaagctccccattggc
ttaggtcaagggctatacgctaaattagacgctaaaatcgctgaagcgatgatggggctt
aacggggtgaaagcagttgaaataggcaagggggtagaaagctctttattaaaaggctca
gagtataacgatttaatggatcaaaaggggtttttgagcaatcgtagtgggggggtttta
gggggcatgagcaatggcgaagaaattattataaaagtgcatttcaaacccacgccaagc
attttccaatctcaacaaaccatagacattaataataatgaatgcgaatgcttgttaaag
ggcaggcatgatccttgcattgcgattagggggagtgtggtgtgcgagagtttgctttca
ttggtgttagctgatatggtattactcaatttgacttcaaaaatagagtatttaaaaacg
atttataatgagaattaa

DBGET integrated database retrieval system