KEGG   Helicobacter pylori 35A: HMPREF4655_21004Help
Entry
HMPREF4655_21004  CDS       T01892                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00550  Peptidoglycan biosynthesis
hpo01100  Metabolic pathways
hpo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hpo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF4655_21004
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HMPREF4655_21004
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hpo01003]
    HMPREF4655_21004
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpo01011]
    HMPREF4655_21004
Enzymes [BR:hpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     HMPREF4655_21004
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HMPREF4655_21004
Glycosyltransferases [BR:hpo01003]
 Polysaccharide
  Bacterial polysaccharide
   HMPREF4655_21004
Peptidoglycan biosynthesis and degradation proteins [BR:hpo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   HMPREF4655_21004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ADU41099
UniProt: E6S247
LinkDB All DBs
Position
989800..991779
Genome map
AA seq 659 aa AA seqDB search
MLKKIFYGFIVLFLIVVGLLAILIAQVWVSTNKDIAKIKDYRPSVASQILDRKGRLIANI
YDKEFRFYARFEEIPPRFIESLLAVEDTLFFEHGGINLDAIMRAMIKNAKSGRYTEGGST
LTQQLVKNMVLTREKTLTRKLKEAIISIRIEKVLSKEEILERYLNQTFFGHGYYGVKTAS
LGYFKKPLDKLTLKEITMLVALPRAPSFYDPTKNLEFSLSRANDILRRLYSLGWISSNEF
KSALNEVPIVYNQTSTQNIAPYVVDEVLKQLDQLDGLKTQGYTIKLTIDLDYQRLALESL
RFGHQKILEKIAKEKPKTNASNEDEDNLNASMIVTDTSTGKILALVGGIDYKKSAFNRAT
QAKRQFGSAIKPFVYQIAFDNGYSTTSKIPDTARNFENGNYSKNSEQNHAWHPSNYSRKF
LGLVTLQEALSHSLNLATINLSDQLGFEKIYQSLSDMGFKNLPKDLSIVLGSFAISPIEA
AEKYSLFSNYGTMLKPMLIESITDQQNDVKTFTPIETKKITSKKQAFLTLSVLMNAVENG
TGSLARIKGLEIAGKTGTSNNNIDAWFIGFTPTLQSVIWFGRDDNTPIGKGATGSVVSAP
VYSYFMRNILAIEPSLKRKFDVPKGLRKEIVDKIPYYSTSNSITPTPQKTDDGEEPLLF
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaaagattttttatggttttatcgttttatttttgattgtcgtagggttgtta
gccattcttatcgctcaagtttgggtgagcacaaataaggatattgctaaaattaaagat
tatcgtccgagcgtcgcttcacagattttagacagaaaagggcgtttgatcgctaatatc
tatgataaggaattccgtttttatgcgcgttttgaagaaatccccccacgatttattgaa
agccttttagcggtagaagacaccctcttttttgaacatggggggatcaatttagacgct
atcatgcgcgctatgattaaaaacgctaaaagcggtcgttacaccgaggggggtagcacc
ctaacccaacaactcgttaaaaacatggtgctcacacgagaaaaaaccctaaccagaaaa
ctcaaagaagctatcatttccatacgcattgaaaaagtcttaagcaaagaagaaatttta
gagcgctatttgaaccaaactttttttgggcatgggtattatggcgtgaaaaccgcaagt
ttagggtattttaaaaaaccccttgacaaactcacgcttaaagaaatcaccatgttagtc
gccctgcctagggctccaagtttttatgaccctaccaaaaatttagaattttcactctct
agggctaatgatattttaaggcggttgtattctttaggctggatttcttctaacgagttc
aaatccgctctcaatgaagtgccaattgtctataaccaaacttccacgcaaaacatcgcc
ccctatgtcgtggatgaagtgttgaaacaattggatcaattagacgggttaaaaactcaa
ggctataccataaagctcacgatagatttggattaccaacgcttagcgttagagtccttg
cgttttgggcatcaaaaaatcttagaaaaaatcgctaaagaaaagccaaaaactaacgcc
tctaatgaagatgaagacaacttgaacgccagcatgatagttacagacacaagcaccggt
aagattttagctctagtggggggaattgattataaaaaaagcgctttcaatcgcgccacg
caagccaaacggcaatttgggagtgcgataaagccttttgtgtatcaaatcgcttttgat
aatggctattccaccacttctaaaatccctgataccgcgcgaaattttgaaaatggtaat
tatagcaaaaacagcgaacaaaaccacgcatggcaccccagcaattattctcgcaagttt
ttagggcttgtaaccttacaagaagctttgagccattcgttaaatctagccacgatcaat
ttaagcgatcagcttggctttgaaaaaatttatcaatctttaagcgatatggggtttaaa
aacctccctaaagacttgtctattgtgttagggagctttgctatctcaccgattgaagcg
gccgaaaagtattctttattttctaattacggcaccatgctcaaacccatgctcattgaa
agcatcactgaccaacaaaacgatgtcaaaactttcacacccattgaaaccaaaaagatc
acctctaaaaaacaggcttttttaaccctttcagtgctgatgaatgcggtagaaaatggc
acagggagtttagctcgcattaaaggtttagaaattgccggtaaaaccgggacttctaac
aacaatattgatgcttggttcattggctttacccccaccttacagagcgtgatctggttt
gggagagacgataacacgcctattggcaaaggagcgacaggaagcgttgtgagtgcgcct
gtgtattcgtatttcatgcgcaatattttagcgatcgaaccttctttaaaaagaaagttt
gatgtccccaaaggcttgcgtaaagaaatcgtggataaaatcccctactactcaacctct
aattctatcacccctaccccacaaaaaaccgacgatggcgaagaacccttattgttctaa

DBGET integrated database retrieval system