KEGG   Helicobacter pylori 35A: HMPREF4655_21173Help
Entry
HMPREF4655_21173  CDS       T01892                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00473  D-Alanine metabolism
hpo01100  Metabolic pathways
hpo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HMPREF4655_21173 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    HMPREF4655_21173 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpo01011]
    HMPREF4655_21173 (alr)
Enzymes [BR:hpo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HMPREF4655_21173 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:hpo01011]
 Precursor biosynthesis
  Racemase
   HMPREF4655_21173 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADU41266
UniProt: E6S2L4
LinkDB All DBs
Position
complement(1173446..1174579)
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVNSASLRHNFSAVKSIVPKDAHIMAVVKANAYGAGAIKASEIFLQEGANYL
GVATLDEALELRSHFSKTPILILGYSPNSNASMLIDNDLSAMIFSLEQAEVFSQMALKSQ
KRLKIHLKIDTGMHRLGLEPNFKSIEIIKKIRALKGLEVEGIFTHLSNADAKIKTHAKNQ
MKAFNAFLEQLLEQKIEFQYRHAYNSAGILSLCNGNENRFLNLYRPGIMLYGFYPSSGMK
ESCPTILKNVISLKAQIVQIRSVKKGEFIGYGEHFYTNEETLVGVLALGYADGLMRALGN
RIQVAINNQLAPLIGKVCMDQCFVKLNNIQAKEGDEVILFGDKSAKANDASEIAALLNTI
PYETISTLSKRLERVYI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtgaatagcgcttctttaaggcataattttagc
gcagtcaaaagcattgtccctaaagacgcccatatcatggcggttgtcaaggcgaacgct
tatggggcaggagccataaaagcgagcgaaattttcttacaagaaggggctaattattta
ggggtagcgacattagatgaagctttggagttgcgctctcatttttctaaaacccccatt
ttgattttaggctatagccctaattctaacgcttccatgctgattgataacgatttgagc
gctatgatttttagccttgaacaagcggaagttttttctcaaatggctttaaaatctcaa
aaacgcttaaaaattcatctcaaaattgataccggcatgcaccgcttgggattagagcct
aattttaaaagcatagaaatcattaaaaaaatccgtgctttaaagggcttggaggtggaa
gggatattcacgcatttaagcaacgctgatgctaagattaaaacccatgctaaaaaccaa
atgaaagcctttaacgcttttttagagcagcttttagaacaaaaaatagagtttcaatac
cgccatgcttacaattccgccggcatcctttctttgtgtaatgggaatgaaaatcgcttc
ttaaacctctatcgcccaggcatcatgctctatggtttttacccctctagtggaatgaaa
gaatcatgcccaaccattttaaaaaatgttatcagtttaaaagctcaaatcgttcaaatc
agaagcgttaaaaaaggtgaatttattggctatggcgagcatttttacaccaatgaagaa
actttagtgggtgttttagctctagggtatgcggacgggttaatgcgcgctttaggcaat
cgcattcaagtagcgatcaataaccaattagccccccttattggcaaggtgtgcatggat
caatgctttgtcaagctcaataatattcaagccaaagagggcgatgaggtcattttgttt
ggggataaaagcgctaaggctaacgacgcaagcgaaatcgctgcgcttttaaacaccatt
ccttatgaaaccatcagcaccctatccaaacgcttggagcgcgtctatatttaa

DBGET integrated database retrieval system